Polycomb protein EED
Details
- Name
- Polycomb protein EED
- Kind
- protein
- Synonyms
- Embryonic ectoderm development protein
- hEED
- WAIT-1
- WD protein associating with integrin cytoplasmic tails 1
- Gene Name
- EED
- UniProtKB Entry
- O75530Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055205|Polycomb protein EED MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR DSSILIAVCDDASIWRWDRLR
- Number of residues
- 441
- Molecular Weight
- 50197.24
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Also recognizes 'Lys-26' trimethylated histone H1 with the effect of inhibiting PRC2 complex methyltransferase activity on nucleosomal histone H3 'Lys-27', whereas H3 'Lys-27' recognition has the opposite effect, enabling the propagation of this repressive mark. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A
- Specific Function
- chromatin binding
- Pfam Domain Function
- WD40 (PF00400)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
- Not Available
- Chromosome Location
- 11
- Locus
- 11q14.2
- External Identifiers
Resource Link UniProtKB ID O75530 UniProtKB Entry Name EED_HUMAN GeneCard ID EED HGNC ID HGNC:3188 PDB ID(s) 3IIW, 3IIY, 3IJ0, 3IJ1, 3IJC, 3JPX, 3JZG, 3JZH, 3JZN, 3K26, 3K27, 4W2R, 4X3E, 5GSA, 5H13, 5H14, 5H15, 5H17, 5H19, 5H24, 5H25, 5HYN, 5IJ7, 5IJ8, 5K0M, 5LS6, 5TTW, 5U5H, 5U5K, 5U5T, 5U62, 5U69, 5U6D, 5U8A, 5U8F, 5WG6, 5WP3, 5WUK, 6B3W, 6C23, 6C24, 6LO2, 6SFB, 6SFC, 6U4Y, 6V3X, 6V3Y, 6W7F, 6W7G, 6WKR, 6YVI, 6YVJ, 7KSO, 7KSR, 7KTP, 7KXT, 7MSB, 7MSD, 7P3C, 7P3G, 7P3J, 7QJG, 7QJU, 7QK4, 7SI4, 7SI5, 7TD5, 8FYH KEGG ID hsa:8726 IUPHAR/Guide To Pharmacology ID 2487 NCBI Gene ID 8726 - General References
- Not Available