Sphingosine 1-phosphate receptor 2
Details
- Name
- Sphingosine 1-phosphate receptor 2
- Kind
- protein
- Synonyms
- EDG5
- Endothelial differentiation G-protein coupled receptor 5
- S1P receptor 2
- S1P receptor Edg-5
- S1P2
- Sphingosine 1-phosphate receptor Edg-5
- Gene Name
- S1PR2
- UniProtKB Entry
- O95136Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055399|Sphingosine 1-phosphate receptor 2 MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
- Number of residues
- 353
- Molecular Weight
- 38866.51
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P) (PubMed:10617617). S1P is a bioactive lysophospholipid that elicits diverse physiological effects on most types of cells and tissues (PubMed:10617617). When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis (PubMed:10617617). Receptor for the chemokine-like protein FAM19A5 (PubMed:29453251). Mediates the inhibitory effect of FAM19A5 on vascular smooth muscle cell proliferation and migration (By similarity)
- Specific Function
- G protein-coupled peptide receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 35-59 67-95 110-128 148-173 190-210 234-255 272-292
- Cellular Location
- Cell membrane
- Gene sequence
- Not Available
- Chromosome Location
- 19
- Locus
- 19p13.2
- External Identifiers
Resource Link UniProtKB ID O95136 UniProtKB Entry Name S1PR2_HUMAN GeneCard ID S1PR2 HGNC ID HGNC:3169 PDB ID(s) 7T6B KEGG ID hsa:9294 IUPHAR/Guide To Pharmacology ID 276 NCBI Gene ID 9294 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details AB-22 investigational yes target inhibitor Details Amiselimod experimental yes target modulator Details