Apelin receptor
Details
- Name
- Apelin receptor
- Kind
- protein
- Synonyms
- AGTRL1
- Angiotensin receptor-like 1
- APJ
- G-protein coupled receptor APJ
- G-protein coupled receptor HG11
- Gene Name
- APLNR
- UniProtKB Entry
- P35414Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0013922|Apelin receptor MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK GGEQMHEKSIPYSQETLVVD
- Number of residues
- 380
- Molecular Weight
- 42660.055
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Receptor for apelin receptor early endogenous ligand (APELA) and apelin (APLN) hormones coupled to G proteins that inhibit adenylate cyclase activity (PubMed:11090199, PubMed:25639753, PubMed:28137936). Plays a key role in early development such as gastrulation, blood vessels formation and heart morphogenesis by acting as a receptor for APELA hormone (By similarity). May promote angioblast migration toward the embryonic midline, i.e. the position of the future vessel formation, during vasculogenesis (By similarity). Promotes sinus venosus (SV)-derived endothelial cells migration into the developing heart to promote coronary blood vessel development (By similarity). Also plays a role in various processes in adults such as regulation of blood vessel formation, blood pressure, heart contractility and heart failure (PubMed:25639753, PubMed:28137936)
- Specific Function
- apelin receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 27-51 67-91 101-125 145-166 201-221 245-271 285-308
- Cellular Location
- Cell membrane
- Gene sequence
- Not Available
- Chromosome Location
- 11
- Locus
- 11q12.1
- External Identifiers
Resource Link UniProtKB ID P35414 UniProtKB Entry Name APJ_HUMAN GeneCard ID APLNR HGNC ID HGNC:339 PDB ID(s) 2LOT, 2LOU, 2LOV, 2LOW, 5VBL, 6KNM, 7SUS, 7W0L, 7W0M, 7W0N, 7W0O, 7W0P, 8XZF, 8XZG, 8XZH, 8XZI, 8XZJ KEGG ID hsa:187 IUPHAR/Guide To Pharmacology ID 36 NCBI Gene ID 187 - General References
- Not Available