Translation initiation factor eIF2B subunit beta
Details
- Name
- Translation initiation factor eIF2B subunit beta
- Kind
- protein
- Synonyms
- eIF2B GDP-GTP exchange factor subunit beta
- EIF2BB
- S20I15
- S20III15
- Gene Name
- EIF2B2
- UniProtKB Entry
- P49770Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0056417|Translation initiation factor eIF2B subunit beta MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
- Number of residues
- 351
- Molecular Weight
- 38989.28
- Theoretical pI
- Not Available
- GO Classification
- FunctionsATP binding / GTP binding / guanyl-nucleotide exchange factor activity / translation initiation factor activityProcessescentral nervous system development / cytoplasmic translational initiation / myelination / oligodendrocyte development / ovarian follicle development / regulation of translational initiation / response to glucose / response to heat / response to peptide hormone / T cell receptor signaling pathway / translational initiationComponentscytoplasm / cytosol / eukaryotic translation initiation factor 2B complex
- General Function
- Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on eukaryotic initiation factor 2 (eIF2) gamma subunit (PubMed:25858979, PubMed:27023709, PubMed:31048492). Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed (PubMed:25858979, PubMed:31048492)
- Specific Function
- ATP binding
- Pfam Domain Function
- IF-2B (PF01008)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm, cytosol
- Gene sequence
- Not Available
- Chromosome Location
- 14
- Locus
- 14q24.3
- External Identifiers
Resource Link UniProtKB ID P49770 UniProtKB Entry Name EI2BB_HUMAN GeneCard ID EIF2B2 HGNC ID HGNC:3258 PDB ID(s) 6CAJ, 6EZO, 6K71, 6K72, 6O81, 6O85, 6O9Z, 7D43, 7D44, 7D45, 7D46, 7F64, 7F66, 7F67, 7KMF, 7L70, 7L7G, 7RLO, 7TRJ, 7VLK, 8TQO, 8TQZ KEGG ID hsa:8892 NCBI Gene ID 8892 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Plinabulin investigational yes target stimulator Details