Nuclear receptor ROR-gamma
Details
- Name
- Nuclear receptor ROR-gamma
- Kind
- protein
- Synonyms
- NR1F3
- Nuclear receptor RZR-gamma
- Nuclear receptor subfamily 1 group F member 3
- RAR-related orphan receptor C
- Retinoid-related orphan receptor-gamma
- RORG
- RZRG
- Gene Name
- RORC
- UniProtKB Entry
- P51449Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0009280|Nuclear receptor ROR-gamma MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
- Number of residues
- 518
- Molecular Weight
- 58194.845
- Theoretical pI
- Not Available
- GO Classification
- FunctionsDNA-binding transcription factor activity / DNA-binding transcription factor activity, RNA polymerase II-specific / DNA-binding transcription repressor activity, RNA polymerase II-specific / ligand-activated transcription factor activity / nuclear receptor activity / oxysterol binding / RNA polymerase II cis-regulatory region sequence-specific DNA binding / sequence-specific double-stranded DNA binding / zinc ion bindingProcessesadipose tissue development / cellular response to sterol / circadian regulation of gene expression / lymph node development / negative regulation of thymocyte apoptotic process / negative regulation of transcription by RNA polymerase II / Peyer's patch development / positive regulation of circadian rhythm / positive regulation of DNA-templated transcription / regulation of fat cell differentiation / regulation of glucose metabolic process / regulation of steroid metabolic process / regulation of transcription by RNA polymerase II / T-helper 17 cell differentiation / T-helper cell differentiation / xenobiotic metabolic processComponentschromatin / nuclear body / nucleoplasm / nucleus
- General Function
- Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism (PubMed:19381306, PubMed:19965867, PubMed:20203100, PubMed:22789990, PubMed:26160376). Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively (PubMed:19965867, PubMed:22789990). Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates the circadian expression of clock genes such as CRY1, BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A (PubMed:19965867). Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1. Also plays a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC1 and PCK1 (PubMed:19965867). Regulates the rhythmic expression of PROX1 and promotes its nuclear localization (PubMed:19381306, PubMed:19965867, PubMed:20203100, PubMed:22789990, PubMed:26160376). Plays an indispensable role in the induction of IFN-gamma dependent anti-mycobacterial systemic immunity (PubMed:26160376)
- Specific Function
- DNA-binding transcription factor activity
- Pfam Domain Function
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
- Not Available
- Chromosome Location
- 1
- Locus
- 1q21.3
- External Identifiers
- General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 25-Hydroxycholesterol experimental yes target agonist Details GSK-2981278 investigational yes target agonist Details