Translation initiation factor eIF2B subunit alpha
Details
- Name
- Translation initiation factor eIF2B subunit alpha
- Kind
- protein
- Synonyms
- eIF2B GDP-GTP exchange factor subunit alpha
- EIF2BA
- Gene Name
- EIF2B1
- UniProtKB Entry
- Q14232Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0057533|Translation initiation factor eIF2B subunit alpha MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL IKLYL
- Number of residues
- 305
- Molecular Weight
- 33711.84
- Theoretical pI
- Not Available
- GO Classification
- Functionsguanyl-nucleotide exchange factor activity / identical protein binding / translation initiation factor activityProcessescytoplasmic translational initiation / oligodendrocyte development / response to glucose / response to heat / response to peptide hormone / T cell receptor signaling pathway / translational initiationComponentscytoplasm / cytosol / eukaryotic translation initiation factor 2B complex / membrane / plasma membrane
- General Function
- Acts as a component of the translation initiation factor 2B (eIF2B) complex, which catalyzes the exchange of GDP for GTP on eukaryotic initiation factor 2 (eIF2) gamma subunit (PubMed:25858979, PubMed:27023709, PubMed:31048492). Its guanine nucleotide exchange factor activity is repressed when bound to eIF2 complex phosphorylated on the alpha subunit, thereby limiting the amount of methionyl-initiator methionine tRNA available to the ribosome and consequently global translation is repressed (PubMed:25858979, PubMed:31048492)
- Specific Function
- guanyl-nucleotide exchange factor activity
- Pfam Domain Function
- IF-2B (PF01008)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm, cytosol
- Gene sequence
- Not Available
- Chromosome Location
- 12
- Locus
- 12q24.31
- External Identifiers
Resource Link UniProtKB ID Q14232 UniProtKB Entry Name EI2BA_HUMAN GeneCard ID EIF2B1 HGNC ID HGNC:3257 PDB ID(s) 3ECS, 6CAJ, 6EZO, 6K71, 6K72, 6O81, 6O85, 6O9Z, 7D43, 7D44, 7D45, 7D46, 7F64, 7F66, 7F67, 7KMA, 7KMF, 7L70, 7L7G, 7RLO, 7TRJ, 7VLK, 8TQZ KEGG ID hsa:1967 NCBI Gene ID 1967 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Plinabulin investigational yes target stimulator Details