Atypical chemokine receptor 1
Details
- Name
- Atypical chemokine receptor 1
- Kind
- protein
- Synonyms
- DARC
- Duffy antigen/chemokine receptor
- FY
- Fy glycoprotein
- Glycoprotein D
- GPD
- GpFy
- Plasmodium vivax receptor
- Gene Name
- ACKR1
- UniProtKB Entry
- Q16570Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0058107|Atypical chemokine receptor 1 MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS ALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGL GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALL TLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
- Number of residues
- 336
- Molecular Weight
- 35552.265
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels
- Specific Function
- C-C chemokine binding
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- 64-84 96-116 130-153 167-187 208-228 245-265 288-308
- Cellular Location
- Early endosome
- Gene sequence
- Not Available
- Chromosome Location
- 1
- Locus
- 1q23.2
- External Identifiers
Resource Link UniProtKB ID Q16570 UniProtKB Entry Name ACKR1_HUMAN GeneCard ID ACKR1 HGNC ID HGNC:4035 PDB ID(s) 4NUU, 4NUV, 7P93, 8A44 KEGG ID hsa:2532 NCBI Gene ID 2532 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details AQ-13 investigational yes target modulator Details Chloroquine approved, investigational, vet_approved yes target modulator Details