Phosphatidylcholine:ceramide cholinephosphotransferase 1
Details
- Name
- Phosphatidylcholine:ceramide cholinephosphotransferase 1
- Kind
- protein
- Synonyms
- 2.7.8.27
- Medulla oblongata-derived protein
- MOB
- Protein Mob
- SMS1
- Sphingomyelin synthase 1
- TMEM23
- Transmembrane protein 23
- Gene Name
- SGMS1
- UniProtKB Entry
- Q86VZ5Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0059393|Phosphatidylcholine:ceramide cholinephosphotransferase 1 MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRL LDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM PELERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRV QWAFSICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGM HFNCSPKLFGDWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYLFIKEYS PRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEAS QMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT
- Number of residues
- 413
- Molecular Weight
- 48616.62
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Major sphingomyelin synthase at the Golgi apparatus (PubMed:14685263, PubMed:17449912). Catalyzes the reversible transfer of phosphocholine moiety in sphingomyelin biosynthesis: in the forward reaction transfers phosphocholine head group of phosphatidylcholine (PC) on to ceramide (CER) to form ceramide phosphocholine (sphingomyelin, SM) and diacylglycerol (DAG) as by-product, and in the reverse reaction transfers phosphocholine from SM to DAG to form PC and CER. The direction of the reaction depends on the levels of CER and DAG in Golgi membranes (PubMed:14685263, PubMed:14976195, PubMed:17449912, PubMed:17982138, PubMed:19454763). Does not use free phosphorylcholine or CDP-choline as donor (PubMed:14685263, PubMed:14976195). Regulates receptor-mediated signal transduction via mitogenic DAG and proapoptotic CER, as well as via SM, a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting (PubMed:14976195, PubMed:17449912, PubMed:17982138). Plays a role in secretory transport via regulation of DAG pool at the Golgi apparatus and its downstream effects on PRKD1 (PubMed:18370930, PubMed:21980337)
- Specific Function
- ceramide cholinephosphotransferase activity
- Pfam Domain Function
- PAP2_C (PF14360)
- Signal Regions
- Not Available
- Transmembrane Regions
- 136-156 184-204 215-235 276-296 304-324
- Cellular Location
- Golgi apparatus membrane
- Gene sequence
- Not Available
- Chromosome Location
- 10
- Locus
- 10q11.23
- External Identifiers
Resource Link UniProtKB ID Q86VZ5 UniProtKB Entry Name SMS1_HUMAN GeneCard ID SGMS1 HGNC ID HGNC:29799 KEGG ID hsa:259230 IUPHAR/Guide To Pharmacology ID 2520 NCBI Gene ID 259230 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Idroxioleic acid investigational yes target modulator Details