Lysophosphatidic acid receptor 1
Details
- Name
- Lysophosphatidic acid receptor 1
- Kind
- protein
- Synonyms
- EDG2
- LPA receptor 1
- LPA-1
- LPA1
- Lysophosphatidic acid receptor Edg-2
- Gene Name
- LPAR1
- UniProtKB Entry
- Q92633Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0060506|Lysophosphatidic acid receptor 1 MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND HSVV
- Number of residues
- 364
- Molecular Weight
- 41108.965
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- Receptor for lysophosphatidic acid (LPA) (PubMed:19306925, PubMed:25025571, PubMed:26091040, PubMed:9070858). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contributes to the responses to tissue damage and infectious agents. Activates downstream signaling cascades via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Signaling inhibits adenylyl cyclase activity and decreases cellular cAMP levels (PubMed:26091040). Signaling triggers an increase of cytoplasmic Ca(2+) levels (PubMed:19656035, PubMed:19733258, PubMed:26091040). Activates RALA; this leads to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate (PubMed:19306925). Signaling mediates activation of down-stream MAP kinases (By similarity). Contributes to the regulation of cell shape. Promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction (PubMed:26091040). Promotes the activation of Rho and the formation of actin stress fibers (PubMed:26091040). Promotes formation of lamellipodia at the leading edge of migrating cells via activation of RAC1 (By similarity). Through its function as LPA receptor, plays a role in chemotaxis and cell migration, including responses to injury and wounding (PubMed:18066075, PubMed:19656035, PubMed:19733258). Plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14. Promotes cell proliferation in response to LPA (By similarity). Inhibits the intracellular ciliogenesis pathway in response to LPA and through AKT1 activation (PubMed:31204173). Required for normal skeleton development. May play a role in osteoblast differentiation. Required for normal brain development. Required for normal proliferation, survival and maturation of newly formed neurons in the adult dentate gyrus. Plays a role in pain perception and in the initiation of neuropathic pain (By similarity)
- Specific Function
- G protein-coupled receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 51-75 84-107 122-144 164-184 205-225 256-280 295-315
- Cellular Location
- Cell surface
- Gene sequence
- Not Available
- Chromosome Location
- 9
- Locus
- 9q31.3
- External Identifiers
Resource Link UniProtKB ID Q92633 UniProtKB Entry Name LPAR1_HUMAN GeneCard ID LPAR1 HGNC ID HGNC:3166 PDB ID(s) 4Z34, 4Z35, 4Z36, 7TD0, 7TD1, 7TD2, 7YU3, 7YU4, 7YU5, 7YU6, 7YU7, 7YU8 KEGG ID hsa:1902 IUPHAR/Guide To Pharmacology ID 272 NCBI Gene ID 1902 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details BMS-986020 investigational yes target antagonist Details Fipaxalparant investigational yes target modulator Details BMS-986278 investigational yes target antagonist Details