rRNA methyltransferase 2, mitochondrial
Details
- Name
- rRNA methyltransferase 2, mitochondrial
- Kind
- protein
- Synonyms
- 16S rRNA (uridine(1369)-2'-O)-methyltransferase
- 16S rRNA [Um1369] 2'-O-methyltransferase
- 2.1.1.-
- FJH1
- FTSJ2
- Protein ftsJ homolog 2
- Gene Name
- MRM2
- UniProtKB Entry
- Q9UI43Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0063657|rRNA methyltransferase 2, mitochondrial MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKL LEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLE GATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSV TPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGR KGTVKQ
- Number of residues
- 246
- Molecular Weight
- 27423.365
- Theoretical pI
- Not Available
- GO Classification
- Not Available
- General Function
- S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA (PubMed:25009282, PubMed:25074936, PubMed:35177605). This activity may require prior 2'-O-methylguanosine modification at position 1370 (Gm1370) by MRM3 (PubMed:35177605). Essential for late-stage assembly of mtLSU required for efficient translation of mitochondrial DNA encoded proteins; methyltransferase activity is not required for this function (PubMed:35177605). Essential for mitochondrial respiratory function (PubMed:35177605)
- Specific Function
- rRNA (uridine-2'-O-)-methyltransferase activity
- Pfam Domain Function
- FtsJ (PF01728)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Mitochondrion
- Gene sequence
- Not Available
- Chromosome Location
- 7
- Locus
- 7p22.3
- External Identifiers
Resource Link UniProtKB ID Q9UI43 UniProtKB Entry Name MRM2_HUMAN GeneCard ID MRM2 HGNC ID HGNC:16352 PDB ID(s) 2NYU, 7O9K, 7O9M, 7ODS KEGG ID hsa:29960 NCBI Gene ID 29960 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Plazomicin approved, investigational yes target inhibitor Details