Verpasep caltespen
Identification
- Generic Name
- Verpasep caltespen
- DrugBank Accession Number
- DB04959
- Background
Verpasep caltespen is a recombinant chimeric protein composed of the heat shock protein 65 (Hsp65) from Mycobacterium bovis, and the human papilloma viral (HPV) protein E7. Hsp65, similar to other members of its family of proteins, elicits a strong immune response and may be used to design vaccines against a number of different cancers. E7 protein is involved in carcinogenesis of anal and cervical tumors, and represents a tumor antigen that may be specifically targeted by lymphocytes. It is being developed by StressGen Biotechnologies Corp.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Fusion proteins - Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>VE7_HPV16 Protein E7 - Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
>CH602_MYCBO 60 kDa chaperonin 2 - Mycobacterium bovis MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIE LEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIE KAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNT FGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLLEKVIG AGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVIS EEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAIAGRVAQIRQEIENSDSDYDR EKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVTLLQA APTLDELKLEGDEATGANIVKVALEAPLKQIAFNSGLEPGVVAEKVRNLPAGHGLNAQTG VYEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAVVADKPEKEKASVPGGGDMGGMDF
Download FASTA Format- Synonyms
- BCG65-E7
- Heat-shock protein HSP 65 (Mycobacterium BCG) fusion protein with transcription factor E7 (human papillomavirus 16)
- HPV 16 E7/HSP65 vaccine
- HPV E7 Peptide Epitope Vaccine
- HspE7
- Recombinant fusion protein of Mycobacterium bovis BCG Hsp65 and HPV16 E7
- Verpasep caltespen
- External IDs
- SGN-00101
Pharmacology
- Indication
Investigated for use/treatment in anal dysplasia, cervical dysplasia/cancer, genital warts, HIV infection, infectious and parasitic disease (unspecified), pediatric indications, warts, and viral infection.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Not Available
- Mechanism of action
HspE7 works by efficiently delivering the E7 antigen to dendritic cells, which have a natural affinity for Hsp. Dendritic cells are known to be the most potent cells in the body for triggering immune responses. Coupling E7 to Hsp takes advantage of the Hsp receptors that dendritic cells express on their surface to introduce E7, as part of a larger fusion protein, into the dendritic cells.
Target Actions Organism UKeratin, type II cytoskeletal 7 Not Available Humans UE3 ubiquitin-protein ligase UBR4 Not Available Humans - Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- Not Available
Categories
- Drug Categories
- Not Available
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- Z7T0JI2E2I
- CAS number
- 295371-00-5
References
- General References
- Palefsky JM, Berry JM, Jay N, Krogstad M, Da Costa M, Darragh TM, Lee JY: A trial of SGN-00101 (HspE7) to treat high-grade anal intraepithelial neoplasia in HIV-positive individuals. AIDS. 2006 May 12;20(8):1151-5. [Article]
- Hunt S: Technology evaluation: HspE7, StressGen Biotechnologies Corp. Curr Opin Mol Ther. 2001 Aug;3(4):413-7. [Article]
- Goldstone SE, Palefsky JM, Winnett MT, Neefe JR: Activity of HspE7, a novel immunotherapy, in patients with anogenital warts. Dis Colon Rectum. 2002 Apr;45(4):502-7. [Article]
- Maciag PC, Paterson Y: Technology evaluation: HspE7 (Stressgen). Curr Opin Mol Ther. 2005 Jun;7(3):256-63. [Article]
- Derkay CS, Smith RJ, McClay J, van Burik JA, Wiatrak BJ, Arnold J, Berger B, Neefe JR: HspE7 treatment of pediatric recurrent respiratory papillomatosis: final results of an open-label trial. Ann Otol Rhinol Laryngol. 2005 Sep;114(9):730-7. [Article]
- External Links
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 2 Completed Prevention Atypical Squamous Cells of Undetermined Significance / Cervical Cancer / HSIL, High Grade Squamous Intraepithelial Lesions / LSIL, Low-Grade Squamous Intraepithelial Lesions 1 2 Completed Prevention Cervical Cancer / Precancerous Conditions 1 2 Completed Treatment Cervical Cancer / Cervical Intraepithelial Neoplasia, Grade III / Human Papillomavirus (HPV) Infections 1 2 Completed Treatment Papilloma / Recurrent Respiratory Papillomatosis 1 2 Unknown Status Treatment Precancerous Conditions 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Structural molecule activity
- Specific Function
- Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
- Gene Name
- KRT7
- Uniprot ID
- P08729
- Uniprot Name
- Keratin, type II cytoskeletal 7
- Molecular Weight
- 51385.11 Da
References
- Kanduc D: Translational regulation of human papillomavirus type 16 E7 mRNA by the peptide SEQIKA, shared by rabbit alpha(1)-globin and human cytokeratin 7. J Virol. 2002 Jul;76(14):7040-8. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Zinc ion binding
- Specific Function
- E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule,...
- Gene Name
- UBR4
- Uniprot ID
- Q5T4S7
- Uniprot Name
- E3 ubiquitin-protein ligase UBR4
- Molecular Weight
- 573835.26 Da
References
- Huh KW, DeMasi J, Ogawa H, Nakatani Y, Howley PM, Munger K: Association of the human papillomavirus type 16 E7 oncoprotein with the 600-kDa retinoblastoma protein-associated factor, p600. Proc Natl Acad Sci U S A. 2005 Aug 9;102(32):11492-7. Epub 2005 Aug 1. [Article]
Drug created at October 21, 2007 22:23 / Updated at July 18, 2023 22:56