Ig lambda chain V-II region MGC
Details
- Name
- Ig lambda chain V-II region MGC
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016940|Ig lambda chain V-II region MGC QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGV PDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLG
- Number of residues
- 111
- Molecular Weight
- 11557.51
- Theoretical pI
- 4.91
- GO Classification
- Functionsantigen bindingProcessescomplement activation / complement activation, classical pathway / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / receptor-mediated endocytosis / regulation of immune responseComponentsextracellular region / plasma membrane
- General Function
- Antigen binding
- Specific Function
- Not Available
- Pfam Domain Function
- V-set (PF07686)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P01709 UniProtKB Entry Name LV206_HUMAN - General References
- Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. [Article]
- Fett FW, Deutsch HF: A new lambda-chain gene. Immunochemistry. 1975 Aug;12(8):643-52. [Article]
- Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. [Article]