Beta-casein

Details

Name
Beta-casein
Synonyms
Not Available
Gene Name
CSN2
Organism
Bovine
Amino acid sequence
>lcl|BSEQ0052642|Beta-casein
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL
QDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPK
HKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSL
SQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Number of residues
224
Molecular Weight
25107.165
Theoretical pI
Not Available
GO Classification
Functions
antioxidant activity / cysteine-type endopeptidase inhibitor activity / enzyme inhibitor activity / metalloendopeptidase inhibitor activity / potassium channel inhibitor activity / protein homodimerization activity
Processes
negative regulation of cysteine-type endopeptidase activity / negative regulation of I-kappaB kinase/NF-kappaB signaling / negative regulation of I-kappaB phosphorylation / negative regulation of inflammatory response / negative regulation of lactation / negative regulation of tumor necrosis factor-mediated signaling pathway / regulation of blood pressure / response to 11-deoxycorticosterone / response to dehydroepiandrosterone / response to estradiol / response to heat / response to progesterone
Components
extracellular space / Golgi apparatus / Golgi lumen
General Function
Important role in determination of the surface properties of the casein micelles.
Specific Function
Antioxidant activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP02666
UniProtKB Entry NameCASB_BOVIN
General References
  1. Jimenez-Flores R, Kang YC, Richardson T: Cloning and sequence analysis of bovine beta-casein cDNA. Biochem Biophys Res Commun. 1987 Jan 30;142(2):617-21. doi: 10.1016/0006-291x(87)90318-4. [Article]
  2. Stewart AF, Bonsing J, Beattie CW, Shah F, Willis IM, Mackinlay AG: Complete nucleotide sequences of bovine alpha S2- and beta-casein cDNAs: comparisons with related sequences in other species. Mol Biol Evol. 1987 May;4(3):231-41. doi: 10.1093/oxfordjournals.molbev.a040437. [Article]
  3. Bonsing J, Ring JM, Stewart AF, Mackinlay AG: Complete nucleotide sequence of the bovine beta-casein gene. Aust J Biol Sci. 1988;41(4):527-37. doi: 10.1071/bi9880527. [Article]
  4. Simons G, van den Heuvel W, Reynen T, Frijters A, Rutten G, Slangen CJ, Groenen M, de Vos WM, Siezen RJ: Overproduction of bovine beta-casein in Escherichia coli and engineering of its main chymosin cleavage site. Protein Eng. 1993 Sep;6(7):763-70. doi: 10.1093/protein/6.7.763. [Article]
  5. Anaya-Lopez JL, Contreras-Guzman OE, Carabez-Trejo A, Baizabal-Aguirre VM, Lopez-Meza JE, Valdez-Alarcon JJ, Ochoa-Zarzosa A: Invasive potential of bacterial isolates associated with subclinical bovine mastitis. Res Vet Sci. 2006 Dec;81(3):358-61. doi: 10.1016/j.rvsc.2006.02.002. Epub 2006 Apr 18. [Article]
  6. Ribadeau Dumas B, Brignon G, Grosclaude F, Mercier JC: [Primary structure of bovine beta casein. Complete sequence]. Eur J Biochem. 1972 Feb;25(3):505-14. doi: 10.1111/j.1432-1033.1972.tb01722.x. [Article]
  7. Carles C, Huet JC, Ribadeau-Dumas B: A new strategy for primary structure determination of proteins: application to bovine beta-casein. FEBS Lett. 1988 Mar 14;229(2):265-72. doi: 10.1016/0014-5793(88)81138-4. [Article]
  8. Han SK, Shin YC, Byun HD: Biochemical, molecular and physiological characterization of a new beta-casein variant detected in Korean cattle. Anim Genet. 2000 Feb;31(1):49-51. doi: 10.1046/j.1365-2052.2000.00582.x. [Article]
  9. Jones DS, Heerma W, van Wassenaar PD, Haverkamp J: Analysis of bovine beta-casein tryptic digest by continuous-flow fast-atom bombardment mass spectrometry. Rapid Commun Mass Spectrom. 1991 Apr;5(4):192-5. doi: 10.1002/rcm.1290050410. [Article]
  10. Lebrun I, Cavallaro V, Juliano L, Juliano MA, de Sousa e Silva MC: Effects of 'casoparan', a peptide isolated from casein hydrolysates with mastoparan-like properties. Mediators Inflamm. 2004 Aug;13(4):263-8. doi: 10.1080/09629350400003068. [Article]
  11. Grosclaude F, Mahe MF, Voglino GF: [The beta E variant and the phosphorylation code of bovine caseins]. FEBS Lett. 1974 Sep 1;45(1):3-5. doi: 10.1016/0014-5793(74)80796-9. [Article]
  12. Ivanov VN, Kershulite DR, Bayev AA, Akhundova AA, Sulimova GE, Judinkova ES, Gorodetsky SI: Identification of bacterial clones encoding bovine caseins by direct immunological screening of the cDNA library. Gene. 1984 Dec;32(3):381-8. doi: 10.1016/0378-1119(84)90013-1. [Article]
  13. Ivanov VN, Kershulite DR, Baev AA, Akhundova AA, Sulimova GE: [Identification of bacterial clones that encode cow's caseins by direct immunological screening of the cDNA library]. Mol Biol (Mosk). 1985 Jul-Aug;19(4):955-63. [Article]
  14. Schmelzer CE, Schops R, Reynell L, Ulbrich-Hofmann R, Neubert RH, Raith K: Peptic digestion of beta-casein. Time course and fate of possible bioactive peptides. J Chromatogr A. 2007 Sep 28;1166(1-2):108-15. doi: 10.1016/j.chroma.2007.08.015. Epub 2007 Aug 9. [Article]
  15. Ribadeau Dumas B, Grosclaude F, Mercier JC: [Localization in the peptide chain of bovine beta casein of the His-Gln substitution differentiating the A2 and A3 genetic variants]. C R Acad Hebd Seances Acad Sci D. 1970 May 11;270(19):2369-72. [Article]
  16. Lebrun I, Lebrun FL, Henriques OB, Carmona AK, Juliano L, Camargo AC: Isolation and characterization of a new bradykinin potentiating octapeptide from gamma-casein. Can J Physiol Pharmacol. 1995 Jan;73(1):85-91. doi: 10.1139/y95-012. [Article]
  17. Perpetuo EA, Juliano L, Lebrun I: Biochemical and pharmacological aspects of two bradykinin-potentiating peptides obtained from tryptic hydrolysis of casein. J Protein Chem. 2003 Nov;22(7-8):601-6. doi: 10.1023/b:jopc.0000008724.98339.ff. [Article]
  18. Visser S, Slangen CJ, Lagerwerf FM, Van Dongen WD, Haverkamp J: Identification of a new genetic variant of bovine beta-casein using reversed-phase high-performance liquid chromatography and mass spectrometric analysis. J Chromatogr A. 1995 Sep 8;711(1):141-50. doi: 10.1016/0021-9673(95)00058-u. [Article]
  19. Willis IM, Stewart AF, Caputo A, Thompson AR, Mackinlay AG: Construction and identification by partial nucleotide sequence analysis of bovine casein and beta-lactoglobulin cDNA clones. DNA. 1982;1(4):375-86. [Article]
  20. Wu SL, Kim J, Hancock WS, Karger B: Extended Range Proteomic Analysis (ERPA): a new and sensitive LC-MS platform for high sequence coverage of complex proteins with extensive post-translational modifications-comprehensive analysis of beta-casein and epidermal growth factor receptor (EGFR). J Proteome Res. 2005 Jul-Aug;4(4):1155-70. [Article]
  21. Imanishi SY, Kochin V, Ferraris SE, de Thonel A, Pallari HM, Corthals GL, Eriksson JE: Reference-facilitated phosphoproteomics: fast and reliable phosphopeptide validation by microLC-ESI-Q-TOF MS/MS. Mol Cell Proteomics. 2007 Aug;6(8):1380-91. doi: 10.1074/mcp.M600480-MCP200. Epub 2007 May 17. [Article]
  22. Grosclaude F, Mahe MF, Mercier JC, Ribadeau-Dumas B: [Characterization of genetic variants of a S1 and bovine caseins]. Eur J Biochem. 1972 Apr 11;26(3):328-37. doi: 10.1111/j.1432-1033.1972.tb01771.x. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails