Beta-casein
Details
- Name
- Beta-casein
- Synonyms
- Not Available
- Gene Name
- CSN2
- Organism
- Bovine
- Amino acid sequence
>lcl|BSEQ0052642|Beta-casein MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL QDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPK HKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSL SQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
- Number of residues
- 224
- Molecular Weight
- 25107.165
- Theoretical pI
- Not Available
- GO Classification
- Functionsantioxidant activity / cysteine-type endopeptidase inhibitor activity / enzyme inhibitor activity / metalloendopeptidase inhibitor activity / potassium channel inhibitor activity / protein homodimerization activityProcessesnegative regulation of cysteine-type endopeptidase activity / negative regulation of I-kappaB kinase/NF-kappaB signaling / negative regulation of I-kappaB phosphorylation / negative regulation of inflammatory response / negative regulation of lactation / negative regulation of tumor necrosis factor-mediated signaling pathway / regulation of blood pressure / response to 11-deoxycorticosterone / response to dehydroepiandrosterone / response to estradiol / response to heat / response to progesteroneComponentsextracellular space / Golgi apparatus / Golgi lumen
- General Function
- Important role in determination of the surface properties of the casein micelles.
- Specific Function
- Antioxidant activity
- Pfam Domain Function
- Casein (PF00363)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P02666 UniProtKB Entry Name CASB_BOVIN - General References
- Jimenez-Flores R, Kang YC, Richardson T: Cloning and sequence analysis of bovine beta-casein cDNA. Biochem Biophys Res Commun. 1987 Jan 30;142(2):617-21. doi: 10.1016/0006-291x(87)90318-4. [Article]
- Stewart AF, Bonsing J, Beattie CW, Shah F, Willis IM, Mackinlay AG: Complete nucleotide sequences of bovine alpha S2- and beta-casein cDNAs: comparisons with related sequences in other species. Mol Biol Evol. 1987 May;4(3):231-41. doi: 10.1093/oxfordjournals.molbev.a040437. [Article]
- Bonsing J, Ring JM, Stewart AF, Mackinlay AG: Complete nucleotide sequence of the bovine beta-casein gene. Aust J Biol Sci. 1988;41(4):527-37. doi: 10.1071/bi9880527. [Article]
- Simons G, van den Heuvel W, Reynen T, Frijters A, Rutten G, Slangen CJ, Groenen M, de Vos WM, Siezen RJ: Overproduction of bovine beta-casein in Escherichia coli and engineering of its main chymosin cleavage site. Protein Eng. 1993 Sep;6(7):763-70. doi: 10.1093/protein/6.7.763. [Article]
- Anaya-Lopez JL, Contreras-Guzman OE, Carabez-Trejo A, Baizabal-Aguirre VM, Lopez-Meza JE, Valdez-Alarcon JJ, Ochoa-Zarzosa A: Invasive potential of bacterial isolates associated with subclinical bovine mastitis. Res Vet Sci. 2006 Dec;81(3):358-61. doi: 10.1016/j.rvsc.2006.02.002. Epub 2006 Apr 18. [Article]
- Ribadeau Dumas B, Brignon G, Grosclaude F, Mercier JC: [Primary structure of bovine beta casein. Complete sequence]. Eur J Biochem. 1972 Feb;25(3):505-14. doi: 10.1111/j.1432-1033.1972.tb01722.x. [Article]
- Carles C, Huet JC, Ribadeau-Dumas B: A new strategy for primary structure determination of proteins: application to bovine beta-casein. FEBS Lett. 1988 Mar 14;229(2):265-72. doi: 10.1016/0014-5793(88)81138-4. [Article]
- Han SK, Shin YC, Byun HD: Biochemical, molecular and physiological characterization of a new beta-casein variant detected in Korean cattle. Anim Genet. 2000 Feb;31(1):49-51. doi: 10.1046/j.1365-2052.2000.00582.x. [Article]
- Jones DS, Heerma W, van Wassenaar PD, Haverkamp J: Analysis of bovine beta-casein tryptic digest by continuous-flow fast-atom bombardment mass spectrometry. Rapid Commun Mass Spectrom. 1991 Apr;5(4):192-5. doi: 10.1002/rcm.1290050410. [Article]
- Lebrun I, Cavallaro V, Juliano L, Juliano MA, de Sousa e Silva MC: Effects of 'casoparan', a peptide isolated from casein hydrolysates with mastoparan-like properties. Mediators Inflamm. 2004 Aug;13(4):263-8. doi: 10.1080/09629350400003068. [Article]
- Grosclaude F, Mahe MF, Voglino GF: [The beta E variant and the phosphorylation code of bovine caseins]. FEBS Lett. 1974 Sep 1;45(1):3-5. doi: 10.1016/0014-5793(74)80796-9. [Article]
- Ivanov VN, Kershulite DR, Bayev AA, Akhundova AA, Sulimova GE, Judinkova ES, Gorodetsky SI: Identification of bacterial clones encoding bovine caseins by direct immunological screening of the cDNA library. Gene. 1984 Dec;32(3):381-8. doi: 10.1016/0378-1119(84)90013-1. [Article]
- Ivanov VN, Kershulite DR, Baev AA, Akhundova AA, Sulimova GE: [Identification of bacterial clones that encode cow's caseins by direct immunological screening of the cDNA library]. Mol Biol (Mosk). 1985 Jul-Aug;19(4):955-63. [Article]
- Schmelzer CE, Schops R, Reynell L, Ulbrich-Hofmann R, Neubert RH, Raith K: Peptic digestion of beta-casein. Time course and fate of possible bioactive peptides. J Chromatogr A. 2007 Sep 28;1166(1-2):108-15. doi: 10.1016/j.chroma.2007.08.015. Epub 2007 Aug 9. [Article]
- Ribadeau Dumas B, Grosclaude F, Mercier JC: [Localization in the peptide chain of bovine beta casein of the His-Gln substitution differentiating the A2 and A3 genetic variants]. C R Acad Hebd Seances Acad Sci D. 1970 May 11;270(19):2369-72. [Article]
- Lebrun I, Lebrun FL, Henriques OB, Carmona AK, Juliano L, Camargo AC: Isolation and characterization of a new bradykinin potentiating octapeptide from gamma-casein. Can J Physiol Pharmacol. 1995 Jan;73(1):85-91. doi: 10.1139/y95-012. [Article]
- Perpetuo EA, Juliano L, Lebrun I: Biochemical and pharmacological aspects of two bradykinin-potentiating peptides obtained from tryptic hydrolysis of casein. J Protein Chem. 2003 Nov;22(7-8):601-6. doi: 10.1023/b:jopc.0000008724.98339.ff. [Article]
- Visser S, Slangen CJ, Lagerwerf FM, Van Dongen WD, Haverkamp J: Identification of a new genetic variant of bovine beta-casein using reversed-phase high-performance liquid chromatography and mass spectrometric analysis. J Chromatogr A. 1995 Sep 8;711(1):141-50. doi: 10.1016/0021-9673(95)00058-u. [Article]
- Willis IM, Stewart AF, Caputo A, Thompson AR, Mackinlay AG: Construction and identification by partial nucleotide sequence analysis of bovine casein and beta-lactoglobulin cDNA clones. DNA. 1982;1(4):375-86. [Article]
- Wu SL, Kim J, Hancock WS, Karger B: Extended Range Proteomic Analysis (ERPA): a new and sensitive LC-MS platform for high sequence coverage of complex proteins with extensive post-translational modifications-comprehensive analysis of beta-casein and epidermal growth factor receptor (EGFR). J Proteome Res. 2005 Jul-Aug;4(4):1155-70. [Article]
- Imanishi SY, Kochin V, Ferraris SE, de Thonel A, Pallari HM, Corthals GL, Eriksson JE: Reference-facilitated phosphoproteomics: fast and reliable phosphopeptide validation by microLC-ESI-Q-TOF MS/MS. Mol Cell Proteomics. 2007 Aug;6(8):1380-91. doi: 10.1074/mcp.M600480-MCP200. Epub 2007 May 17. [Article]
- Grosclaude F, Mahe MF, Mercier JC, Ribadeau-Dumas B: [Characterization of genetic variants of a S1 and bovine caseins]. Eur J Biochem. 1972 Apr 11;26(3):328-37. doi: 10.1111/j.1432-1033.1972.tb01771.x. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details