Cytochrome P450 3A1

Details

Name
Cytochrome P450 3A1
Synonyms
  • 1.14.14.1
  • Cyp3a-1
  • CYPIIIA1
  • Cytochrome P450-PCN1
Gene Name
Cyp3a1
Organism
Rat
Amino acid sequence
>lcl|BSEQ0020792|Cytochrome P450 3A1
MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWKF
DVECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAVSV
AKDEEWKRYRALLSPTFTSGRLKEMFPIIEQYGDILVKYLKQEAETGKPVTMKKVFGAYS
MDVITSTSFGVNVDSLNNPKDPFVEKTKKLLRFDFFDPLFLSVVLFPFLTPIYEMLNICM
FPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQS
IIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMV
LNETLRLYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERF
SKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSR
QGLLQPTKPIILKVVPRDEIITGS
Number of residues
504
Molecular Weight
57917.375
Theoretical pI
Not Available
GO Classification
Functions
aromatase activity / demethylase activity / heme binding / iron ion binding / testosterone 6-beta-hydroxylase activity
Processes
aging / drug metabolic process / oxidative demethylation / response to cadmium ion / response to drug / response to glucocorticoid / response to metal ion / response to nutrient
Components
endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Testosterone 6-beta-hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP04800
UniProtKB Entry NameCP3A1_RAT
General References
  1. Gonzalez FJ, Nebert DW, Hardwick JP, Kasper CB: Complete cDNA and protein sequence of a pregnenolone 16 alpha-carbonitrile-induced cytochrome P-450. A representative of a new gene family. J Biol Chem. 1985 Jun 25;260(12):7435-41. [Article]
  2. Ribeiro V, Lechner MC: Cloning and characterization of a novel CYP3A1 allelic variant: analysis of CYP3A1 and CYP3A2 sex-hormone-dependent expression reveals that the CYP3A2 gene is regulated by testosterone. Arch Biochem Biophys. 1992 Feb 14;293(1):147-52. [Article]
  3. Nagata K, Gonzalez FJ, Yamazoe Y, Kato R: Purification and characterization of four catalytically active testosterone 6 beta-hydroxylase P-450s from rat liver microsomes: comparison of a novel form with three structurally and functionally related forms. J Biochem. 1990 May;107(5):718-25. [Article]
  4. Cooper KO, Reik LM, Jayyosi Z, Bandiera S, Kelley M, Ryan DE, Daniel R, McCluskey SA, Levin W, Thomas PE: Regulation of two members of the steroid-inducible cytochrome P450 subfamily (3A) in rats. Arch Biochem Biophys. 1993 Mar;301(2):345-54. [Article]
  5. Burger HJ, Schuetz JD, Schuetz EG, Guzelian PS: Paradoxical transcriptional activation of rat liver cytochrome P-450 3A1 by dexamethasone and the antiglucocorticoid pregnenolone 16 alpha-carbonitrile: analysis by transient transfection into primary monolayer cultures of adult rat hepatocytes. Proc Natl Acad Sci U S A. 1992 Mar 15;89(6):2145-9. [Article]
  6. Telhada MB, Pereira TM, Lechner MC: Effect of dexamethasone and phenobarbital on run-on transcription rate and CYP3A mRNA concentration in rat liver: changes during development. Arch Biochem Biophys. 1992 Nov 1;298(2):715-25. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08834Tauroursodeoxycholic acidexperimental, investigationalunknowninducerDetails
DB13746Bioallethrinapproved, experimentalnosubstrateDetails
DB01645GenisteininvestigationalunknownsubstrateDetails
DB00603Medroxyprogesterone acetateapproved, investigationalunknownsubstrateDetails