HTH-type transcriptional regulator QacR

Details

Name
HTH-type transcriptional regulator QacR
Synonyms
Not Available
Gene Name
qacR
Organism
Staphylococcus aureus
Amino acid sequence
>lcl|BSEQ0012752|HTH-type transcriptional regulator QacR
MNLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESK
WQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLE
NKYIDAYHVIFKEGNLNGEWCINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQ
IFLNGLSK
Number of residues
188
Molecular Weight
22174.175
Theoretical pI
8.55
GO Classification
Functions
DNA binding / transcription factor activity, sequence-specific DNA binding
Processes
negative regulation of transcription, DNA-templated / transcription, DNA-templated
General Function
Transcriptional repressor of qacA. Binds to IR1, an unusually long 28 bp operator, which is located downstream from the qacA promoter and overlaps its transcription start site. QacR is induced from its IR1 site by binding to one of many structurally dissimilar cationic lipophilic compounds, which are also substrates of QacA.
Specific Function
Dna binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0012753|PG:9487076 QACR, PSK1_P27; STAPHYLOCOCCUS AUREUS PLASMID PSK1; ORF188; SIMILAR TO KNOWN REGULATORS SUCH AS TET REGULATOR TN10; K18938 TETR/ACRR FAMILY TRANSCRIPTIONAL REGULATOR, REPRESSOR FOR QACA (N)
ATGAACTTGAAAGATAAAATACTAGGTGTCGCAAAGGAATTATTTATAAAAAATGGATAT
AATGCCACTACTACTGGAGAAATTGTTAAATTATCAGAAAGTAGTAAAGGGAATCTTTAT
TATCACTTTAAAACAAAAGAAAATCTATTTTTAGAAATTTTAAATATAGAAGAATCTAAA
TGGCAAGAACAGTGGAAAAAGGAACAAATCAAATGTAAAACTAATAGAGAAAAATTTTAT
TTATATAATGAACTATCTTTAACAACCGAATACTATTATCCACTTCAAAACGCAATAATT
GAATTTTACACTGAATATTATAAAACTAATAGCATTAATGAAAAAATGAATAAATTAGAA
AACAAATATATAGATGCTTATCATGTAATTTTTAAGGAGGGTAATTTAAATGGCGAATGG
TGTATTAATGATGTTAATGCTGTTAGTAAAATAGCAGCAAACGCTGTTAATGGAATTGTT
ACCTTTACACATGAACAAAATATTAATGAAAGAATTAAACTTATGAACAAGTTCTCTCAA
ATTTTTTTAAATGGACTTAGTAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A0N4
UniProtKB Entry NameQACR_STAAU
GenBank Protein ID46660
GenBank Gene IDX56628
General References
  1. Rouch DA, Cram DS, DiBerardino D, Littlejohn TG, Skurray RA: Efflux-mediated antiseptic resistance gene qacA from Staphylococcus aureus: common ancestry with tetracycline- and sugar-transport proteins. Mol Microbiol. 1990 Dec;4(12):2051-62. [Article]
  2. Jensen SO, Apisiridej S, Kwong SM, Yang YH, Skurray RA, Firth N: Analysis of the prototypical Staphylococcus aureus multiresistance plasmid pSK1. Plasmid. 2010 Nov;64(3):135-42. doi: 10.1016/j.plasmid.2010.06.001. Epub 2010 Jun 12. [Article]
  3. Grkovic S, Brown MH, Roberts NJ, Paulsen IT, Skurray RA: QacR is a repressor protein that regulates expression of the Staphylococcus aureus multidrug efflux pump QacA. J Biol Chem. 1998 Jul 17;273(29):18665-73. [Article]
  4. Grkovic S, Brown MH, Schumacher MA, Brennan RG, Skurray RA: The staphylococcal QacR multidrug regulator binds a correctly spaced operator as a pair of dimers. J Bacteriol. 2001 Dec;183(24):7102-9. [Article]
  5. Schumacher MA, Miller MC, Grkovic S, Brown MH, Skurray RA, Brennan RG: Structural mechanisms of QacR induction and multidrug recognition. Science. 2001 Dec 7;294(5549):2158-63. [Article]
  6. Schumacher MA, Miller MC, Grkovic S, Brown MH, Skurray RA, Brennan RG: Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR. EMBO J. 2002 Mar 1;21(5):1210-8. [Article]
  7. Schumacher MA, Brennan RG: Deciphering the molecular basis of multidrug recognition: crystal structures of the Staphylococcus aureus multidrug binding transcription regulator QacR. Res Microbiol. 2003 Mar;154(2):69-77. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03608DiminazeneexperimentalunknownDetails
DB03808Hexamidineapproved, experimentalunknownDetails
DB01123ProflavineapprovedunknownDetails
DB04209Dequaliniumapproved, investigationalunknownDetails