Beta-lactamase SHV-1

Details

Name
Beta-lactamase SHV-1
Synonyms
  • 3.5.2.6
  • PIT-2
  • shv1
Gene Name
bla
Organism
Escherichia coli
Amino acid sequence
>lcl|BSEQ0021982|Beta-lactamase SHV-1
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Number of residues
286
Molecular Weight
31223.635
Theoretical pI
8.08
GO Classification
Functions
beta-lactamase activity
Processes
beta-lactam antibiotic catabolic process / response to antibiotic
General Function
Beta-lactamase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0003988|861 bp
ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACAC
GCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTA
GGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAA
CGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTG
GATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGAC
TACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCC
GCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTACTGGCCACCGTCGGCGGC
CCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGC
TGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCC
AGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAA
CGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTG
CTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAGCGGGGTGCGCGCGGG
ATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGG
GATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTG
ATCGAGCACTGGCAACGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0AD63
UniProtKB Entry NameBLA1_ECOLX
GenBank Protein ID5002312
GenBank Gene IDAF148850
General References
  1. Bradford PA: Automated thermal cycling is superior to traditional methods for nucleotide sequencing of bla(SHV) genes. Antimicrob Agents Chemother. 1999 Dec;43(12):2960-3. [Article]
  2. Barthelemy M, Peduzzi J, Labia R: Complete amino acid sequence of p453-plasmid-mediated PIT-2 beta-lactamase (SHV-1). Biochem J. 1988 Apr 1;251(1):73-9. [Article]
  3. Barthelemy M, Peduzzi J, Labia R: N-terminal amino acid sequence of PIT-2 beta-lactamase (SHV-1) J Antimicrob Chemother. 1987 Jun;19(6):839-41. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02579Acrylic AcidexperimentalunknownDetails
DB03057MalonaldehydeexperimentalunknownDetails
DB03445(3S)-3-(dioxidosulfanyl)-N-[(1E)-3-oxoprop-1-en-1-yl]-4-(1H-1,2,3-triazol-1-yl)-D-valineexperimentalunknownDetails
DB03472Cyclohexyl-Hexyl-Beta-D-MaltosideexperimentalunknownDetails
DB03834(3S)-3-(dioxidosulfanyl)-N-[(1Z)-3-oxoprop-1-en-1-yl]-4-(1H-1,2,3-triazol-1-yl)-D-valineexperimentalunknownDetails
DB03970(7R)-7-(6,7-Dihydro-5H-cyclopenta[d]imidazo[2,1-b][1,3]thiazol-2-yl)-2,7-dihydro-1,4-thiazepine-3,6-dicarboxylic acidexperimentalunknownDetails
DB09060AvibactamapprovedyesinhibitorDetails
DB01606TazobactamapprovedyesinhibitorDetails
DB12377Relebactamapproved, investigationalyesinhibitorDetails
DB01598ImipenemapprovednosubstrateDetails