Interleukin-12 subunit beta
Details
- Name
- Interleukin-12 subunit beta
- Synonyms
- CLMF p40
- Cytotoxic lymphocyte maturation factor 40 kDa subunit
- IL-12 subunit p40
- IL-12B
- NK cell stimulatory factor chain 2
- NKSF2
- Gene Name
- IL12B
- UniProtKB Entry
- P29460Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0016273|Interleukin-12 subunit beta MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC RKNASISVRAQDRYYSSSWSEWASVPCS
- Number of residues
- 328
- Molecular Weight
- 37168.645
- Theoretical pI
- 5.47
- GO Classification
- Functionscytokine receptor activity / identical protein binding / interleukin-12 alpha subunit binding / interleukin-12 receptor binding / protein heterodimerization activityProcessescell migration / cellular response to lipopolysaccharide / defense response to Gram-negative bacterium / defense response to protozoan / defense response to virus / natural killer cell activation / natural killer cell activation involved in immune response / negative regulation of inflammatory response to antigenic stimulus / negative regulation of interleukin-10 production / negative regulation of interleukin-17 production / negative regulation of smooth muscle cell proliferation / positive regulation of activated T cell proliferation / positive regulation of cell adhesion / positive regulation of defense response to virus by host / positive regulation of granulocyte macrophage colony-stimulating factor production / positive regulation of inflammatory response / positive regulation of interleukin-10 production / positive regulation of interleukin-12 production / positive regulation of interleukin-17 production / positive regulation of lymphocyte proliferation / positive regulation of memory T cell differentiation / positive regulation of mononuclear cell proliferation / positive regulation of natural killer cell activation / positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target / positive regulation of natural killer cell proliferation / positive regulation of NK T cell activation / positive regulation of NK T cell proliferation / positive regulation of osteoclast differentiation / positive regulation of smooth muscle cell apoptotic process / positive regulation of T cell mediated cytotoxicity / positive regulation of T cell proliferation / positive regulation of T-helper 1 type immune response / positive regulation of T-helper 17 cell lineage commitment / positive regulation of T-helper 17 type immune response / positive regulation of tissue remodeling / positive regulation of tumor necrosis factor production / response to UV-B / sexual reproduction / T-helper 1 type immune response / T-helper cell differentiationComponentsextracellular space / interleukin-12 complex / interleukin-23 complex
- General Function
- Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC
- Specific Function
- cytokine activity
- Pfam Domain Function
- IL12p40_C (PF10420)
- Signal Regions
- 1-22
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0016274|Interleukin-12 subunit beta (IL12B) ATGTGTCACCAGCAGTTGGTCATCTCTTGGTTTTCCCTGGTTTTTCTGGCATCTCCCCTC GTGGCCATATGGGAACTGAAGAAAGATGTTTATGTCGTAGAATTGGATTGGTATCCGGAT GCCCCTGGAGAAATGGTGGTCCTCACCTGTGACACCCCTGAAGAAGATGGTATCACCTGG ACCTTGGACCAGAGCAGTGAGGTCTTAGGCTCTGGCAAAACCCTGACCATCCAAGTCAAA GAGTTTGGAGATGCTGGCCAGTACACCTGTCACAAAGGAGGCGAGGTTCTAAGCCATTCG CTCCTGCTGCTTCACAAAAAGGAAGATGGAATTTGGTCCACTGATATTTTAAAGGACCAG AAAGAACCCAAAAATAAGACCTTTCTAAGATGCGAGGCCAAGAATTATTCTGGACGTTTC ACCTGCTGGTGGCTGACGACAATCAGTACTGATTTGACATTCAGTGTCAAAAGCAGCAGA GGCTCTTCTGACCCCCAAGGGGTGACGTGCGGAGCTGCTACACTCTCTGCAGAGAGAGTC AGAGGGGACAACAAGGAGTATGAGTACTCAGTGGAGTGCCAGGAGGACAGTGCCTGCCCA GCTGCTGAGGAGAGTCTGCCCATTGAGGTCATGGTGGATGCCGTTCACAAGCTCAAGTAT GAAAACTACACCAGCAGCTTCTTCATCAGGGACATCATCAAACCTGACCCACCCAAGAAC TTGCAGCTGAAGCCATTAAAGAATTCTCGGCAGGTGGAGGTCAGCTGGGAGTACCCTGAC ACCTGGAGTACTCCACATTCCTACTTCTCCCTGACATTCTGCGTTCAGGTCCAGGGCAAG AGCAAGAGAGAAAAGAAAGATAGAGTCTTCACGGACAAGACCTCAGCCACGGTCATCTGC CGCAAAAATGCCAGCATTAGCGTGCGGGCCCAGGACCGCTACTATAGCTCATCTTGGAGC GAATGGGCATCTGTGCCCTGCAGTTAG
- Chromosome Location
- 5
- Locus
- 5q33.3
- External Identifiers
Resource Link UniProtKB ID P29460 UniProtKB Entry Name IL12B_HUMAN GenBank Protein ID 180626 GenBank Gene ID M65272 GeneCard ID IL12B GenAtlas ID IL12B HGNC ID HGNC:5970 PDB ID(s) 1F42, 1F45, 3D85, 3D87, 3DUH, 3HMX, 3QWR, 4GRW, 5MJ3, 5MJ4, 5MXA, 5MZV, 5NJD, 6UIB, 6WDQ, 8CR8, 8OE4 KEGG ID hsa:3593 NCBI Gene ID 3593 - General References
- Gubler U, Chua AO, Schoenhaut DS, Dwyer CM, McComas W, Motyka R, Nabavi N, Wolitzky AG, Quinn PM, Familletti PC, et al.: Coexpression of two distinct genes is required to generate secreted bioactive cytotoxic lymphocyte maturation factor. Proc Natl Acad Sci U S A. 1991 May 15;88(10):4143-7. [Article]
- Wolf SF, Temple PA, Kobayashi M, Young D, Dicig M, Lowe L, Dzialo R, Fitz L, Ferenz C, Hewick RM, et al.: Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells. J Immunol. 1991 May 1;146(9):3074-81. [Article]
- Huang D, Cancilla MR, Morahan G: Complete primary structure, chromosomal localisation, and definition of polymorphisms of the gene encoding the human interleukin-12 p40 subunit. Genes Immun. 2000 Dec;1(8):515-20. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Stern AS, Podlaski FJ, Hulmes JD, Pan YC, Quinn PM, Wolitzky AG, Familletti PC, Stremlo DL, Truitt T, Chizzonite R, et al.: Purification to homogeneity and partial characterization of cytotoxic lymphocyte maturation factor from human B-lymphoblastoid cells. Proc Natl Acad Sci U S A. 1990 Sep;87(17):6808-12. [Article]
- Gearing DP, Cosman D: Homology of the p40 subunit of natural killer cell stimulatory factor (NKSF) with the extracellular domain of the interleukin-6 receptor. Cell. 1991 Jul 12;66(1):9-10. [Article]
- D'Andrea A, Ma X, Aste-Amezaga M, Paganin C, Trinchieri G: Stimulatory and inhibitory effects of interleukin (IL)-4 and IL-13 on the production of cytokines by human peripheral blood mononuclear cells: priming for IL-12 and tumor necrosis factor alpha production. J Exp Med. 1995 Feb 1;181(2):537-46. [Article]
- Doucey MA, Hess D, Blommers MJ, Hofsteenge J: Recombinant human interleukin-12 is the second example of a C-mannosylated protein. Glycobiology. 1999 May;9(5):435-41. [Article]
- Altare F, Lammas D, Revy P, Jouanguy E, Doffinger R, Lamhamedi S, Drysdale P, Scheel-Toellner D, Girdlestone J, Darbyshire P, Wadhwa M, Dockrell H, Salmon M, Fischer A, Durandy A, Casanova JL, Kumararatne DS: Inherited interleukin 12 deficiency in a child with bacille Calmette-Guerin and Salmonella enteritidis disseminated infection. J Clin Invest. 1998 Dec 15;102(12):2035-40. [Article]
- Oppmann B, Lesley R, Blom B, Timans JC, Xu Y, Hunte B, Vega F, Yu N, Wang J, Singh K, Zonin F, Vaisberg E, Churakova T, Liu M, Gorman D, Wagner J, Zurawski S, Liu Y, Abrams JS, Moore KW, Rennick D, de Waal-Malefyt R, Hannum C, Bazan JF, Kastelein RA: Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12. Immunity. 2000 Nov;13(5):715-25. [Article]
- Picard C, Fieschi C, Altare F, Al-Jumaah S, Al-Hajjar S, Feinberg J, Dupuis S, Soudais C, Al-Mohsen IZ, Genin E, Lammas D, Kumararatne DS, Leclerc T, Rafii A, Frayha H, Murugasu B, Wah LB, Sinniah R, Loubser M, Okamoto E, Al-Ghonaium A, Tufenkeji H, Abel L, Casanova JL: Inherited interleukin-12 deficiency: IL12B genotype and clinical phenotype of 13 patients from six kindreds. Am J Hum Genet. 2002 Feb;70(2):336-48. Epub 2001 Dec 17. [Article]
- Capon F, Di Meglio P, Szaub J, Prescott NJ, Dunster C, Baumber L, Timms K, Gutin A, Abkevic V, Burden AD, Lanchbury J, Barker JN, Trembath RC, Nestle FO: Sequence variants in the genes for the interleukin-23 receptor (IL23R) and its ligand (IL12B) confer protection against psoriasis. Hum Genet. 2007 Sep;122(2):201-6. Epub 2007 Jun 22. [Article]
- Huffmeier U, Lascorz J, Bohm B, Lohmann J, Wendler J, Mossner R, Reich K, Traupe H, Kurrat W, Burkhardt H, Reis A: Genetic variants of the IL-23R pathway: association with psoriatic arthritis and psoriasis vulgaris, but no specific risk factor for arthritis. J Invest Dermatol. 2009 Feb;129(2):355-8. doi: 10.1038/jid.2008.233. Epub 2008 Sep 18. [Article]
- Yoon C, Johnston SC, Tang J, Stahl M, Tobin JF, Somers WS: Charged residues dominate a unique interlocking topography in the heterodimeric cytokine interleukin-12. EMBO J. 2000 Jul 17;19(14):3530-41. [Article]
- Beyer BM, Ingram R, Ramanathan L, Reichert P, Le HV, Madison V, Orth P: Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody. J Mol Biol. 2008 Oct 17;382(4):942-55. doi: 10.1016/j.jmb.2008.08.001. Epub 2008 Aug 7. [Article]
- Lupardus PJ, Garcia KC: The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12. J Mol Biol. 2008 Oct 17;382(4):931-41. doi: 10.1016/j.jmb.2008.07.051. Epub 2008 Jul 25. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Interleukin-12 subunit beta (Humans) protein primaryInterleukin-23 (Humans) protein - Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 5-Mercapto-2-Nitro-Benzoic Acid experimental unknown target Details Ustekinumab approved, investigational yes target inhibitor Details Briakinumab investigational unknown target Details humanized SMART Anti-IL-12 Antibody investigational unknown target Details Isoprenaline approved, investigational yes target modulator Details Ustekinumab approved, investigational yes target inhibitor Details Tildrakizumab approved, investigational yes target antagonist Details Risankizumab approved, investigational yes target inhibitor Details