Lantibiotic cinnamycin
Details
- Name
- Lantibiotic cinnamycin
- Synonyms
- Lanthiopeptin
- Lantibiotic Ro 09-0198
- rocA
- Gene Name
- cinA
- Organism
- Streptomyces griseoverticillatus
- Amino acid sequence
>lcl|BSEQ0017073|Lantibiotic cinnamycin MTASILQQSVVDADFRAALLENPAAFGASAAALPTPVEAQDQASLDFWTKDIAATEAFAC RQSCSFGPFTFVCDGNTK
- Number of residues
- 78
- Molecular Weight
- 8205.045
- Theoretical pI
- 3.93
- GO Classification
- Processescytolysis / defense response to bacterium
- General Function
- Not Available
- Specific Function
- Can act as inhibitor of the enzyme phospholipase A2, and of the angiotensin-converting enzyme. Shows inhibitory activities against herpes simplex virus and immunopotentiating activities. Its antimicrobial activities are not very pronounced.
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0006539|237 bp ATGACCGCTTCCATTCTTCAGCAGTCCGTCGTGGACGCCGACTTCCGCGCGGCGCTGCTT GAGAACCCCGCCGCCTTCGGCGCTTCCGCCGCGGCCCTGCCCACGCCCGTCGAGGCCCAG GACCAGGCGTCCCTTGACTTCTGGACCAAGGACATCGCCGCCACGGAAGCCTTCGCCTGC CGCCAGAGCTGCAGCTTCGGCCCGTTCACCTTCGTGTGCGACGGCAACACCAAGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P29827 UniProtKB Entry Name CINA_STRGV GenBank Gene ID X58545 - General References
- Kaletta C, Entian KD, Jung G: Prepeptide sequence of cinnamycin (Ro 09-0198): the first structural gene of a duramycin-type lantibiotic. Eur J Biochem. 1991 Jul 15;199(2):411-5. [Article]
- Fredenhagen A, Fendrich G, Marki F, Marki W, Gruner J, Raschdorf F, Peter HH: Duramycins B and C, two new lanthionine containing antibiotics as inhibitors of phospholipase A2. Structural revision of duramycin and cinnamycin. J Antibiot (Tokyo). 1990 Nov;43(11):1403-12. [Article]
- Naruse N, Tenmyo O, Tomita K, Konishi M, Miyaki T, Kawaguchi H, Fukase K, Wakamiya T, Shiba T: Lanthiopeptin, a new peptide antibiotic. Production, isolation and properties of lanthiopeptin. J Antibiot (Tokyo). 1989 Jun;42(6):837-45. [Article]