Envelope protein F13

Details

Name
Envelope protein F13
Synonyms
  • 37 kDa protein
  • p37K
  • Palmitoylated EV membrane protein
Gene Name
Not Available
Organism
Variola virus (isolate Human/India/Ind3/1967)
Amino acid sequence
>lcl|BSEQ0051980|Envelope protein F13
MWPFTSAPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTT
RGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGC
FWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSVKNSWLNL
YSSACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLRSAKTSIDIEHLA
IVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATAESLDALCVQN
DLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFER
DWVSSHSKSLKI
Number of residues
372
Molecular Weight
41902.245
Theoretical pI
Not Available
GO Classification
Functions
catalytic activity
Processes
viral budding via host ESCRT complex
Components
host cell endoplasmic reticulum membrane / viral envelope / viral membrane / virion membrane
General Function
Envelope protein associated with the inner side of the enveloped virion (EV) membrane.
Specific Function
Catalytic activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Virion membrane
Gene sequence
>lcl|BSEQ0051981|Envelope protein F13
ATGTGGCCATTTACATCAGCACCTGCGGGAGCAAAATGTAGACTGGTAGAAACACTACCA
GAAAATATGGATTTTAGATCCGATCATTTGACAACATTTGAATGTTTTAACGAAATTATC
ACTCTAGCTAAGAAATATATATACATAGCATCTTTTTGTTGTAATCCTCTGAGTACGACT
AGGGGAGCGCTTATTTTTGATAAACTAAAAGAGGCATCTGAAAAAGGGATTAAAATAATA
GTTTTGCTAGATGAACGAGGGAAAAGAAATCTGGGAGAGCTACAAAGTCACTGCCCGGAT
ATAAATTTTATAACCGTTAATATTGATAAAAAAAATAACGTAGGACTACTACTTGGATGT
TTTTGGGTATCAGATGATGAAAGATGTTATGTAGGAAACGCGTCATTTACTGGAGGATCT
ATACATACAATTAAAACGTTAGGTGTATATTCTGATTATCCACCACTGGCCACAGATCTT
CGTAGAAGATTTGATACTTTTAAAGCCTTTAATAGCGTAAAAAATTCATGGTTGAATTTA
TACTCTTCGGCTTGTTGTCTGCCAGTTAGCACTGCGTATCATATTAAGAATCCTATAGGT
GGAGTGTTCTTTACTGATTCTCCGGAACACCTATTGGGATATTCTAGAGATCTAGATACC
GATGTAGTTATTGATAAACTTAGGTCAGCTAAAACTAGTATAGATATTGAACATTTGGCA
ATAGTTCCCACTACACGTGTCGATGGTAATAGCTACTATTGGCCCGACATTTACAACTCC
ATTATAGAAGCAGCCATTAATAGAGGAGTTAAGATCAGACTTTTAGTTGGTAATTGGGAT
AAGAACGACGTATATTCTATGGCAACCGCCGAAAGTCTAGATGCGTTGTGTGTTCAAAAT
GATCTATCTGTGAAGGTTTTCACTATTCAGAATAATACAAAATTGTTGATAGTCGACGAT
GAATATGTTCATATCACGTCGGCAAATTTTGACGGAACCCATTACCAAAATCACGGATTT
GTTAGTTTTAATAGTATAGATAAACAGCTTGTAAGCGAGGCTAAAAAAATATTTGAGAGA
GATTGGGTATCTAGCCACAGTAAATCGTTAAAAATTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP33815
UniProtKB Entry NameF13_VAR67
General References
  1. Shchelkunov SN, Blinov VM, Resenchuk SM, Totmenin AV, Sandakhchiev LS: Analysis of the nucleotide sequence of a 43 kbp segment of the genome of variola virus India-1967 strain. Virus Res. 1993 Dec;30(3):239-58. [PubMed:8109158]
  2. Shchelkunov SN, Blinov VM, Sandakhchiev LS: Genes of variola and vaccinia viruses necessary to overcome the host protective mechanisms. FEBS Lett. 1993 Mar 15;319(1-2):80-3. [PubMed:8384129]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12020Tecovirimatapproved, investigationalyesinhibitorDetails