D(2) dopamine receptor

Details

Name
D(2) dopamine receptor
Synonyms
  • Dopamine D2 receptor
Gene Name
Drd2
Organism
Rat
Amino acid sequence
>lcl|BSEQ0051634|D(2) dopamine receptor
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Number of residues
444
Molecular Weight
50903.415
Theoretical pI
Not Available
GO Classification
Functions
dopamine binding / dopamine neurotransmitter receptor activity / dopamine neurotransmitter receptor activity, coupled via Gi/Go / drug binding / G-protein coupled receptor activity / identical protein binding / ionotropic glutamate receptor binding / protein heterodimerization activity / protein homodimerization activity / receptor binding
Processes
acid secretion / activation of protein kinase activity / adenohypophysis development / adenylate cyclase-inhibiting dopamine receptor signaling pathway / adenylate cyclase-modulating G-protein coupled receptor signaling pathway / adult behavior / adult walking behavior / arachidonic acid secretion / associative learning / auditory behavior / axonogenesis / behavioral response to cocaine / behavioral response to ethanol / branching morphogenesis of a nerve / cellular potassium ion homeostasis / cerebral cortex GABAergic interneuron migration / circadian regulation of gene expression / dopamine metabolic process / dopamine receptor signaling pathway / feeding behavior / forebrain development / G-protein coupled receptor internalization / G-protein coupled receptor signaling pathway / grooming behavior / intracellular signal transduction / locomotory behavior / long-term memory / modulation of chemical synaptic transmission / negative regulation of adenylate cyclase activity / negative regulation of blood pressure / negative regulation of cell migration / negative regulation of cell proliferation / negative regulation of circadian sleep/wake cycle, sleep / negative regulation of cytosolic calcium ion concentration / negative regulation of dopamine receptor signaling pathway / negative regulation of dopamine secretion / negative regulation of innate immune response / negative regulation of insulin secretion / negative regulation of protein kinase B signaling / negative regulation of protein secretion / negative regulation of synaptic transmission, glutamatergic / negative regulation of voltage-gated calcium channel activity / neurological system process involved in regulation of systemic arterial blood pressure / neuron-neuron synaptic transmission / orbitofrontal cortex development / peristalsis / phospholipase C-activating dopamine receptor signaling pathway / pigmentation / positive regulation of cytokinesis / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / positive regulation of dopamine uptake involved in synaptic transmission / positive regulation of ERK1 and ERK2 cascade / positive regulation of G-protein coupled receptor protein signaling pathway / positive regulation of glial cell-derived neurotrophic factor secretion / positive regulation of growth hormone secretion / positive regulation of long-term synaptic potentiation / positive regulation of mitotic nuclear division / positive regulation of multicellular organism growth / positive regulation of neuroblast proliferation / positive regulation of receptor internalization / positive regulation of renal sodium excretion / positive regulation of transcription by RNA polymerase II / positive regulation of urine volume / prepulse inhibition / protein localization / regulation of cAMP metabolic process / regulation of dopamine secretion / regulation of dopamine uptake involved in synaptic transmission / regulation of heart rate / regulation of locomotion involved in locomotory behavior / regulation of long-term neuronal synaptic plasticity / regulation of MAPK cascade / regulation of phosphoprotein phosphatase activity / regulation of potassium ion transport / regulation of sodium ion transport / regulation of synapse structural plasticity / regulation of synaptic transmission, GABAergic / release of sequestered calcium ion into cytosol / response to amphetamine / response to axon injury / response to cocaine / response to drug / response to ethanol / response to histamine / response to hypoxia / response to inactivity / response to iron ion / response to light stimulus / response to morphine / response to nicotine / response to toxic substance / sensory perception of smell / startle response / striatum development / synapse assembly / synaptic transmission, dopaminergic / temperature homeostasis / visual learning / Wnt signaling pathway
Components
acrosomal vesicle / axon / axon terminus / cell / ciliary membrane / cytoplasmic vesicle / dendrite / dendritic spine / endocytic vesicle / integral component of plasma membrane / lateral plasma membrane / membrane / non-motile cilium / perikaryon / plasma membrane / postsynaptic density / sperm flagellum / synaptic vesicle membrane
General Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
Specific Function
Dopamine binding
Pfam Domain Function
Transmembrane Regions
38-60 71-93 109-130 152-172 189-213 375-396 411-432
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0051635|D(2) dopamine receptor (Drd2)
ATGGATCCACTGAACCTGTCCTGGTACGATGACGATCTGGAGAGGCAGAACTGGAGCCGG
CCCTTCAATGGGTCAGAAGGGAAGGCAGACAGGCCCCACTACAACTACTATGCCATGCTG
CTCACCCTCCTCATCTTTATCATCGTCTTTGGCAATGTGCTGGTGTGCATGGCTGTATCC
CGAGAGAAGGCTTTGCAGACCACCACCAACTACTTGATAGTCAGCCTTGCTGTGGCTGAT
CTTCTGGTGGCCACACTGGTAATGCCGTGGGTTGTCTACCTGGAGGTGGTGGGTGAGTGG
AAATTCAGCAGGATTCACTGTGACATCTTTGTCACTCTGGATGTCATGATGTGCACAGCA
AGCATCCTGAACCTGTGTGCCATCAGCATTGACAGGTACACAGCTGTGGCAATGCCCATG
CTGTATAACACACGCTACAGCTCCAAGCGCCGAGTTACTGTCATGATTGCCATTGTCTGG
GTCCTGTCCTTCACCATCTCCTGCCCACTGCTCTTCGGACTCAACAATACAGACCAGAAT
GAGTGTATCATTGCCAACCCTGCCTTTGTGGTCTACTCCTCCATTGTCTCATTCTACGTG
CCCTTCATCGTCACTCTGCTGGTCTATATCAAAATCTACATCGTCCTCCGGAAGCGCCGG
AAGCGGGTCAACACCAAGCGCAGCAGTCGAGCTTTCAGAGCCAACCTGAAGACACCACTC
AAGGGCAACTGTACCCACCCTGAGGACATGAAACTCTGCACCGTTATCATGAAGTCTAAT
GGGAGTTTCCCAGTGAACAGGCGGAGAATGGATGCTGCCCGCCGAGCTCAGGAGCTGGAA
ATGGAGATGCTGTCAAGCACCAGTCCCCCAGAGAGGACCCGGTATAGCCCCATCCCTCCC
AGTCACCACCAGCTCACTCTCCCTGATCCATCCCACCACGGCCTACATAGCAACCCTGAC
AGTCCTGCCAAACCAGAGAAGAATGGGCACGCCAAGATTGTCAATCCCAGGATTGCCAAG
TTCTTTGAGATCCAGACCATGCCCAATGGCAAAACCCGGACCTCCCTTAAGACGATGAGC
CGCAGAAAGCTCTCCCAGCAGAAGGAGAAGAAAGCCACTCAGATGCTTGCCATTGTTCTC
GGTGTGTTCATCATCTGCTGGCTGCCCTTCTTCATCACGCACATCCTGAATATACACTGT
GATTGCAACATCCCACCAGTCCTCTACAGCGCCTTCACATGGCTGGGCTATGTCAACAGT
GCCGTCAACCCCATCATCTACACCACCTTCAACATCGAGTTCCGCAAGGCCTTCATGAAG
ATCTTGCACTGCTGA
Chromosome Location
8
Locus
8q23
External Identifiers
ResourceLink
UniProtKB IDP61169
UniProtKB Entry NameDRD2_RAT
General References
  1. Bunzow JR, Van Tol HH, Grandy DK, Albert P, Salon J, Christie M, Machida CA, Neve KA, Civelli O: Cloning and expression of a rat D2 dopamine receptor cDNA. Nature. 1988 Dec 22-29;336(6201):783-7. doi: 10.1038/336783a0. [Article]
  2. Eidne KA, Taylor PL, Zabavnik J, Saunders PT, Inglis JD: D2 receptor, a missing exon. Nature. 1989 Dec 21-28;342(6252):865. doi: 10.1038/342865a0. [Article]
  3. Giros B, Sokoloff P, Martres MP, Riou JF, Emorine LJ, Schwartz JC: Alternative splicing directs the expression of two D2 dopamine receptor isoforms. Nature. 1989 Dec 21-28;342(6252):923-6. doi: 10.1038/342923a0. [Article]
  4. Monsma FJ Jr, McVittie LD, Gerfen CR, Mahan LC, Sibley DR: Multiple D2 dopamine receptors produced by alternative RNA splicing. Nature. 1989 Dec 21-28;342(6252):926-9. doi: 10.1038/342926a0. [Article]
  5. Rao DD, McKelvy J, Kebabian J, MacKenzie RG: Two forms of the rat D2 dopamine receptor as revealed by the polymerase chain reaction. FEBS Lett. 1990 Apr 9;263(1):18-22. [Article]
  6. Miller JC, Wang Y, Filer D: Identification by sequence analysis of a second rat brain cDNA encoding the dopamine (D2) receptor. Biochem Biophys Res Commun. 1990 Jan 15;166(1):109-12. [Article]
  7. O'Dowd BF, Nguyen T, Tirpak A, Jarvie KR, Israel Y, Seeman P, Niznik HB: Cloning of two additional catecholamine receptors from rat brain. FEBS Lett. 1990 Mar 12;262(1):8-12. [Article]
  8. Cox BA, Henningsen RA, Spanoyannis A, Neve RL, Neve KA: Contributions of conserved serine residues to the interactions of ligands with dopamine D2 receptors. J Neurochem. 1992 Aug;59(2):627-35. [Article]
  9. Smith FD, Oxford GS, Milgram SL: Association of the D2 dopamine receptor third cytoplasmic loop with spinophilin, a protein phosphatase-1-interacting protein. J Biol Chem. 1999 Jul 9;274(28):19894-900. [Article]
  10. Griffon N, Jeanneteau F, Prieur F, Diaz J, Sokoloff P: CLIC6, a member of the intracellular chloride channel family, interacts with dopamine D(2)-like receptors. Brain Res Mol Brain Res. 2003 Sep 10;117(1):47-57. [Article]
  11. Bartlett SE, Enquist J, Hopf FW, Lee JH, Gladher F, Kharazia V, Waldhoer M, Mailliard WS, Armstrong R, Bonci A, Whistler JL: Dopamine responsiveness is regulated by targeted sorting of D2 receptors. Proc Natl Acad Sci U S A. 2005 Aug 9;102(32):11521-6. doi: 10.1073/pnas.0502418102. Epub 2005 Jul 27. [Article]
  12. Namkung Y, Dipace C, Javitch JA, Sibley DR: G protein-coupled receptor kinase-mediated phosphorylation regulates post-endocytic trafficking of the D2 dopamine receptor. J Biol Chem. 2009 May 29;284(22):15038-51. doi: 10.1074/jbc.M900388200. Epub 2009 Mar 30. [Article]
  13. Livingstone CD, Strange PG, Naylor LH: Molecular modelling of D2-like dopamine receptors. Biochem J. 1992 Oct 1;287 ( Pt 1):277-82. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails