Cytochrome c oxidase polypeptide 2A
Details
- Name
- Cytochrome c oxidase polypeptide 2A
- Synonyms
- 1.9.3.1
- Cytochrome c ba(3) subunit IIA
- Cytochrome c oxidase polypeptide IIA
- Cytochrome cba3 subunit 2A
- Gene Name
- cbaD
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- Amino acid sequence
>lcl|BSEQ0012717|Cytochrome c oxidase polypeptide 2A MEEKPKGALAVILVLTLTILVFWLGVYAVFFARG
- Number of residues
- 34
- Molecular Weight
- 3766.595
- Theoretical pI
- 9.25
- GO Classification
- Functionscytochrome-c oxidase activityComponentsintegral component of membrane / plasma membrane / respiratory chain
- General Function
- Cytochrome-c oxidase activity
- Specific Function
- Not Available
- Pfam Domain Function
- CoxIIa (PF08113)
- Transmembrane Regions
- 4-34
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0012718|Cytochrome c oxidase polypeptide 2A (cbaD) ATGGAAGAAAAGCCCAAAGGCGCACTGGCGGTCATCCTGGTCCTGACCCTCACCATCCTG GTCTTCTGGCTGGGAGTGTACGCCGTCTTCTTCGCTAGGGGGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P82543 UniProtKB Entry Name COXA_THET8 GenBank Protein ID 55771383 GenBank Gene ID AP008226 - General References
- Soulimane T, Than ME, Dewor M, Huber R, Buse G: Primary structure of a novel subunit in ba3-cytochrome oxidase from Thermus thermophilus. Protein Sci. 2000 Nov;9(11):2068-73. [Article]
- Soulimane T, Buse G, Bourenkov GP, Bartunik HD, Huber R, Than ME: Structure and mechanism of the aberrant ba(3)-cytochrome c oxidase from thermus thermophilus. EMBO J. 2000 Apr 17;19(8):1766-76. [Article]