Cytochrome b6-f complex subunit 5
Details
- Name
- Cytochrome b6-f complex subunit 5
- Synonyms
- Cytochrome b6-f complex subunit PetG
- Cytochrome b6-f complex subunit V
- Gene Name
- petG
- Organism
- Mastigocladus laminosus
- Amino acid sequence
>lcl|BSEQ0012724|Cytochrome b6-f complex subunit 5 MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
- Number of residues
- 37
- Molecular Weight
- 4014.67
- Theoretical pI
- 4.43
- GO Classification
- Functionselectron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activityProcessescytochrome complex assembly / oxidation-reduction process / photosynthesisComponentscytochrome b6f complex / integral component of membrane / thylakoid membrane
- General Function
- Electron transporter, transferring electrons within cytochrome b6/f complex of photosystem ii activity
- Specific Function
- Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex.
- Pfam Domain Function
- PetG (PF02529)
- Transmembrane Regions
- 5-25
- Cellular Location
- Cellular thylakoid membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P83797 UniProtKB Entry Name PETG_MASLA - General References
- Kurisu G, Zhang H, Smith JL, Cramer WA: Structure of the cytochrome b6f complex of oxygenic photosynthesis: tuning the cavity. Science. 2003 Nov 7;302(5647):1009-14. Epub 2003 Oct 2. [Article]