Trefoil factor 2
Details
- Name
- Trefoil factor 2
- Synonyms
- SML1
- SP
- Spasmolysin
- Spasmolytic polypeptide
- Gene Name
- TFF2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0020768|Trefoil factor 2 MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFD SSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFF PKSVEDCHY
- Number of residues
- 129
- Molecular Weight
- 14284.12
- Theoretical pI
- Not Available
- GO Classification
- Processescalcium-mediated signaling / chemokine-mediated signaling pathway / digestion / negative regulation of gastric acid secretion / negative regulation of inflammatory response / negative regulation of macrophage activation / positive regulation of cell proliferation / positive regulation of ERK1 and ERK2 cascade / regulation of cell migrationComponentsextracellular exosome / extracellular space / intracellular
- General Function
- Not Available
- Specific Function
- Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains (By similarity).
- Pfam Domain Function
- Trefoil (PF00088)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0020769|Trefoil factor 2 (TFF2) ATGGGACGGCGAGACGCCCAGCTCCTGGCAGCGCTCCTCGTCCTGGGGCTATGTGCCCTG GCGGGGAGTGAGAAACCCTCCCCCTGCCAGTGCTCCAGGCTGAGCCCCCATAACAGGACG AACTGCGGCTTCCCTGGAATCACCAGTGACCAGTGTTTTGACAATGGATGCTGTTTCGAC TCCAGTGTCACTGGGGTCCCCTGGTGTTTCCACCCCCTCCCAAAGCAAGAGTCGGATCAG TGCGTCATGGAGGTCTCAGACCGAAGAAACTGTGGCTACCCGGGCATCAGCCCCGAGGAA TGCGCCTCTCGGAAGTGCTGCTTCTCCAACTTCATCTTTGAAGTGCCCTGGTGCTTCTTC CCGAAGTCTGTGGAAGACTGCCATTACTAA
- Chromosome Location
- 21
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q03403 UniProtKB Entry Name TFF2_HUMAN HGNC ID HGNC:11756 - General References
- Tomasetto C, Rio MC, Gautier C, Wolf C, Hareuveni M, Chambon P, Lathe R: hSP, the domain-duplicated homolog of pS2 protein, is co-expressed with pS2 in stomach but not in breast carcinoma. EMBO J. 1990 Feb;9(2):407-14. [Article]
- Seib T, Blin N, Hilgert K, Seifert M, Theisinger B, Engel M, Dooley S, Zang KD, Welter C: The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22.3. Genomics. 1997 Feb 15;40(1):200-2. [Article]
- Berry A, Scott HS, Kudoh J, Talior I, Korostishevsky M, Wattenhofer M, Guipponi M, Barras C, Rossier C, Shibuya K, Wang J, Kawasaki K, Asakawa S, Minoshima S, Shimizu N, Antonarakis S, Bonne-Tamir B: Refined localization of autosomal recessive nonsyndromic deafness DFNB10 locus using 34 novel microsatellite markers, genomic structure, and exclusion of six known genes in the region. Genomics. 2000 Aug 15;68(1):22-9. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]