Serine protease inhibitor Kazal-type 6
Details
- Name
- Serine protease inhibitor Kazal-type 6
- Synonyms
- Kallikrein inhibitor
- Gene Name
- SPINK6
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0017470|Serine protease inhibitor Kazal-type 6 MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCA FCKAIVKSGGKISLKHPGKC
- Number of residues
- 80
- Molecular Weight
- 8584.965
- Theoretical pI
- Not Available
- GO Classification
- Functionsserine-type endopeptidase inhibitor activityProcessesnegative regulation of serine-type endopeptidase activityComponentsextracellular region
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Serine protease inhibitor selective for kallikreins. Efficiently inhibits KLK4, KLK5, KLK6, KLK7, KLK12, KLK13 and KLK14. Doesn't inhibit KLK8.
- Pfam Domain Function
- Kazal_1 (PF00050)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0017471|Serine protease inhibitor Kazal-type 6 (SPINK6) ATGAAACTGTCAGGCATGTTTCTGCTCCTCTCTCTGGCTCTTTTCTGCTTTTTAACAGGT GTCTTCAGTCAGGGAGGACAGGTTGACTGTGGTGAGTTCCAGGACCCCAAGGTCTACTGC ACTCGGGAATCTAACCCACACTGTGGCTCTGATGGCCAGACATATGGCAATAAATGTGCC TTCTGTAAGGCCATAGTGAAAAGTGGTGGAAAGATTAGCCTAAAGCATCCTGGAAAATGC TGA
- Chromosome Location
- 5
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q6UWN8 UniProtKB Entry Name ISK6_HUMAN HGNC ID HGNC:29486 - General References
- Meyer-Hoffert U, Wu Z, Kantyka T, Fischer J, Latendorf T, Hansmann B, Bartels J, He Y, Glaser R, Schroder JM: Isolation of SPINK6 in human skin: selective inhibitor of kallikrein-related peptidases. J Biol Chem. 2010 Oct 15;285(42):32174-81. doi: 10.1074/jbc.M109.091850. Epub 2010 Jul 28. [Article]
- Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [Article]
- Kantyka T, Fischer J, Wu Z, Declercq W, Reiss K, Schroder JM, Meyer-Hoffert U: Inhibition of kallikrein-related peptidases by the serine protease inhibitor of Kazal-type 6. Peptides. 2011 Jun;32(6):1187-92. doi: 10.1016/j.peptides.2011.03.009. Epub 2011 Mar 23. [Article]