Ferredoxin CarAc
Details
- Name
- Ferredoxin CarAc
- Synonyms
- Carbazole 1,9a-dioxygenase, ferredoxin component
- CARDO
- Gene Name
- carAc
- Organism
- Pseudomonas resinovorans
- Amino acid sequence
>lcl|BSEQ0012650|Ferredoxin CarAc MNQIWLKVCAASDMQPGTIRRVNRVGAAPLAVYRVGDQFYATEDTCTHGIASLSEGTLDG DVIECPFHGGAFNVCTGMPASSPCTVPLGVFEVEVKEGEVYVAGEKK
- Number of residues
- 107
- Molecular Weight
- 11366.87
- Theoretical pI
- 4.57
- GO Classification
- Functions2 iron, 2 sulfur cluster binding / dioxygenase activity / ferredoxin hydrogenase activity / metal ion bindingProcessescarbazole catabolic process
- General Function
- Metal ion binding
- Specific Function
- Part of the multicomponent carbazole 1,9a-dioxygenase (CARDO), that converts carbazole (CAR) into 2-aminobiphenyl-2,3-diol. Acts as a mediator in the electron transfer from CarAd to CarAa.
- Pfam Domain Function
- Rieske (PF00355)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0012651|Ferredoxin CarAc (carAc) ATGAACCAAATTTGGTTGAAAGTATGTGCTGCATCTGACATGCAACCTGGCACGATACGT CGCGTCAACCGCGTAGGTGCTGCACCTCTCGCAGTCTATCGTGTTGGCGATCAGTTCTAC GCCACTGAAGATACGTGCACGCATGGTATTGCTTCGCTTTCGGAAGGGACACTCGATGGT GACGTGATTGAATGTCCCTTTCACGGCGGCGCCTTCAATGTTTGTACCGGCATGCCGGCA TCAAGTCCATGTACAGTGCCGCTAGGAGTGTTCGAGGTAGAAGTCAAAGAGGGCGAAGTT TATGTCGCCGGAGAAAAGAAGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q8GI16 UniProtKB Entry Name CARAC_PSERE GenBank Protein ID 13094153 GenBank Gene ID AB047548 - General References
- Sato SI, Ouchiyama N, Kimura T, Nojiri H, Yamane H, Omori T: Cloning of genes involved in carbazole degradation of Pseudomonas sp. strain CA10: nucleotide sequences of genes and characterization of meta-cleavage enzymes and hydrolase. J Bacteriol. 1997 Aug;179(15):4841-9. [Article]
- Sato SI, Nam JW, Kasuga K, Nojiri H, Yamane H, Omori T: Identification and characterization of genes encoding carbazole 1,9a-dioxygenase in Pseudomonas sp. strain CA10. J Bacteriol. 1997 Aug;179(15):4850-8. [Article]
- Nojiri H, Sekiguchi H, Maeda K, Urata M, Nakai S, Yoshida T, Habe H, Omori T: Genetic characterization and evolutionary implications of a car gene cluster in the carbazole degrader Pseudomonas sp. strain CA10. J Bacteriol. 2001 Jun;183(12):3663-79. [Article]
- Maeda K, Nojiri H, Shintani M, Yoshida T, Habe H, Omori T: Complete nucleotide sequence of carbazole/dioxin-degrading plasmid pCAR1 in Pseudomonas resinovorans strain CA10 indicates its mosaicity and the presence of large catabolic transposon Tn4676. J Mol Biol. 2003 Feb 7;326(1):21-33. [Article]
- Urata M, Miyakoshi M, Kai S, Maeda K, Habe H, Omori T, Yamane H, Nojiri H: Transcriptional regulation of the ant operon, encoding two-component anthranilate 1,2-dioxygenase, on the carbazole-degradative plasmid pCAR1 of Pseudomonas resinovorans strain CA10. J Bacteriol. 2004 Oct;186(20):6815-23. [Article]
- Shintani M, Yano H, Habe H, Omori T, Yamane H, Tsuda M, Nojiri H: Characterization of the replication, maintenance, and transfer features of the IncP-7 plasmid pCAR1, which carries genes involved in carbazole and dioxin degradation. Appl Environ Microbiol. 2006 May;72(5):3206-16. [Article]
- Miyakoshi M, Shintani M, Terabayashi T, Kai S, Yamane H, Nojiri H: Transcriptome analysis of Pseudomonas putida KT2440 harboring the completely sequenced IncP-7 plasmid pCAR1. J Bacteriol. 2007 Oct;189(19):6849-60. Epub 2007 Aug 3. [Article]
- Takahashi Y, Shintani M, Li L, Yamane H, Nojiri H: Carbazole-degradative IncP-7 plasmid pCAR1.2 is structurally unstable in Pseudomonas fluorescens Pf0-1, which accumulates catechol, the intermediate of the carbazole degradation pathway. Appl Environ Microbiol. 2009 Jun;75(12):3920-9. doi: 10.1128/AEM.02373-08. Epub 2009 Apr 17. [Article]
- Takahashi Y, Shintani M, Yamane H, Nojiri H: The complete nucleotide sequence of pCAR2: pCAR2 and pCAR1 were structurally identical IncP-7 carbazole degradative plasmids. Biosci Biotechnol Biochem. 2009 Mar 23;73(3):744-6. Epub 2009 Mar 7. [Article]
- Miyakoshi M, Nishida H, Shintani M, Yamane H, Nojiri H: High-resolution mapping of plasmid transcriptomes in different host bacteria. BMC Genomics. 2009 Jan 9;10:12. doi: 10.1186/1471-2164-10-12. [Article]
- Shintani M, Takahashi Y, Tokumaru H, Kadota K, Hara H, Miyakoshi M, Naito K, Yamane H, Nishida H, Nojiri H: Response of the Pseudomonas host chromosomal transcriptome to carriage of the IncP-7 plasmid pCAR1. Environ Microbiol. 2010 Jun;12(6):1413-26. doi: 10.1111/j.1462-2920.2009.02110.x. Epub 2009 Nov 23. [Article]
- Yun CS, Suzuki C, Naito K, Takeda T, Takahashi Y, Sai F, Terabayashi T, Miyakoshi M, Shintani M, Nishida H, Yamane H, Nojiri H: Pmr, a histone-like protein H1 (H-NS) family protein encoded by the IncP-7 plasmid pCAR1, is a key global regulator that alters host function. J Bacteriol. 2010 Sep;192(18):4720-31. doi: 10.1128/JB.00591-10. Epub 2010 Jul 16. [Article]
- Nam JW, Nojiri H, Noguchi H, Uchimura H, Yoshida T, Habe H, Yamane H, Omori T: Purification and characterization of carbazole 1,9a-dioxygenase, a three-component dioxygenase system of Pseudomonas resinovorans strain CA10. Appl Environ Microbiol. 2002 Dec;68(12):5882-90. [Article]
- Nam JW, Noguchi H, Fujimoto Z, Mizuno H, Ashikawa Y, Abo M, Fushinobu S, Kobashi N, Wakagi T, Iwata K, Yoshida T, Habe H, Yamane H, Omori T, Nojiri H: Crystal structure of the ferredoxin component of carbazole 1,9a-dioxygenase of Pseudomonas resinovorans strain CA10, a novel Rieske non-heme iron oxygenase system. Proteins. 2005 Mar 1;58(4):779-89. [Article]
- Ashikawa Y, Fujimoto Z, Noguchi H, Habe H, Omori T, Yamane H, Nojiri H: Electron transfer complex formation between oxygenase and ferredoxin components in Rieske nonheme iron oxygenase system. Structure. 2006 Dec;14(12):1779-89. [Article]