O-GlcNAcase NagJ

Details

Name
O-GlcNAcase NagJ
Synonyms
  • 3.2.1.169
  • Beta-hexosaminidase
  • Beta-N-acetylglucosaminidase
  • Beta-N-acetylhexosaminidase
  • Hexosaminidase B
  • N-acetyl-beta-D-glucosaminidase
  • N-acetyl-beta-glucosaminidase
Gene Name
nagJ
Organism
Clostridium perfringens (strain 13 / Type A)
Amino acid sequence
>lcl|BSEQ0017074|O-GlcNAcase NagJ
MKRKMLKRLLTSAFACMFIANGLITTTVRAVGPKTGEENQVLVPNLNPTPENLEVVGDGF
KITSSINLVGEEEADENAVNALREFLTANNIEINSENDPNSTTLIIGEVDDDIPELDEAL
NGTTAENLKEEGYALVSNDGKIAIEGKDGDGTFYGVQTFKQLVKESNIPEVNITDYPTVS
ARGIVEGFYGTPWTHKDRLDQIKFYGENKLNTYIYAPKDDPYHREKWREPYPENEMQRMQ
ELIDASAENKVDFVFGISPGIDIRFDGEAGEEDFNHLIAKAESLYDMGVRSFAIYWDDIQ
DKSAAKHAQVLNRFNEEFVKAKGDVKPLITVPTEYDTGAMVSNGQPRTYTRIFAETVDPS
IEVMWTGPGVVTNEIPLSDAQLISGIYNRNMAVWWNYPVTDYFKGKLALGPMHGLDKGLN
QYVDFFTVNPMEHAELSKISIHTAADYSWNMDNYDYDKAWNRAIDMLYGDLAEDMKVFAN
HSTRMDNKTWAKSGREDAPELRAKMDELWNKLSSKEDASALIEELYGEFARMEEACNNLK
ANLPEVALEECSRQLDELITLAQGDKASLDMIVAQLNEDTEAYESAKEIAQNKLNTALSS
FAVISEKVAQSFIQEALSFDLTLINPRTVKITASSEETSGENAPASFASDGDMNTFWHSK
WSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTL
EDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHGKLKEAAEVTGSVS
LEALEEVQVGENIEVGVGIDELVNAEAFAYDFTLNYDENAFEYVEAISDDGVFVNAKKIE
DGKVRVLVSSLTGEPLPAKEVLAKVVLRAEAKTEGSNLSVTNSSVGDGEGLVHEIAGTEK
TVNIIEGTSPEIVVNPVRDFKASEINKKNVTVTWTEPETTEGLEGYILYKDGKKVAEIGK
DETSYTFKKLNRHTIYNFKIAAKYSNGEVSSKESLTLRTAR
Number of residues
1001
Molecular Weight
111107.99
Theoretical pI
4.36
GO Classification
Functions
beta-N-acetylhexosaminidase activity / carbohydrate binding
General Function
Carbohydrate binding
Specific Function
Binds carbohydrates. Capable of hydrolyzing the glycosidic link of O-GlcNAcylated proteins. Can bind and deglycosylate O-glycosylated peptides from mammals. Can use p-nitrophenyl-beta-GlcNAc and 4-methylumbelliferone-GlcNAc as substrates (in vitro).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017075|O-GlcNAcase NagJ (nagJ)
ATGAAAAGAAAAATGCTTAAAAGACTTTTAACTTCAGCGTTTGCTTGTATGTTTATTGCA
AATGGCTTAATAACTACTACTGTAAGAGCTGTAGGACCTAAAACTGGGGAAGAAAACCAG
GTTTTAGTTCCAAATTTAAATCCAACACCAGAAAATTTAGAGGTTGTAGGAGATGGATTT
AAGATAACTTCTTCTATAAATTTAGTTGGTGAGGAAGAGGCAGATGAGAATGCAGTAAAT
GCTTTAAGGGAATTTTTAACTGCAAACAACATAGAAATAAATAGTGAAAATGATCCAAAT
TCAACTACCCTTATAATAGGTGAGGTTGATGATGATATTCCTGAGTTAGATGAAGCTTTA
AATGGAACTACAGCAGAAAATTTAAAAGAAGAGGGATATGCTTTAGTTTCAAATGATGGG
AAAATAGCTATTGAAGGTAAAGATGGAGATGGAACTTTCTATGGAGTTCAAACATTTAAG
CAATTAGTTAAGGAATCTAATATACCAGAAGTGAATATAACTGATTATCCAACAGTTAGT
GCTAGGGGTATTGTAGAAGGTTTTTATGGAACTCCTTGGACACATAAAGATAGATTAGAT
CAGATTAAATTTTATGGAGAAAATAAATTAAACACATATATTTATGCTCCTAAAGATGAT
CCATATCACAGAGAAAAATGGAGAGAGCCATATCCAGAAAATGAAATGCAAAGAATGCAA
GAACTTATAGATGCTTCTGCTGAAAATAAGGTTGATTTTGTTTTCGGTATTTCTCCAGGA
ATAGATATAAGATTTGATGGAGAAGCAGGAGAAGAAGATTTTAATCATTTAATAGCTAAA
GCAGAATCTTTATATGACATGGGTGTAAGAAGTTTTGCAATCTATTGGGATGATATTCAA
GATAAGAGTGCAGCTAAACATGCTCAAGTTTTAAATAGATTTAATGAAGAATTTGTAAAG
GCTAAGGGAGATGTAAAACCATTAATAACAGTCCCAACAGAGTATGATACTGGAGCTATG
GTAAGTAATGGACAACCTAGAACTTATACTAGAATTTTTGCAGAAACTGTTGATCCTAGT
ATAGAAGTTATGTGGACTGGTCCTGGAGTTGTTACAAATGAAATTCCTTTAAGTGATGCA
CAACTTATAAGTGGAATATACAATAGAAATATGGCAGTATGGTGGAATTATCCAGTAACA
GATTATTTTAAAGGTAAGCTTGCCTTAGGACCAATGCATGGATTAGATAAAGGATTAAAT
CAATATGTAGATTTCTTTACTGTAAATCCAATGGAGCATGCTGAGCTTTCAAAAATATCA
ATACACACAGCTGCTGACTATAGCTGGAATATGGATAACTATGATTATGATAAGGCTTGG
AATAGAGCAATTGATATGCTTTATGGTGATTTAGCAGAAGATATGAAGGTATTTGCAAAC
CATTCAACAAGAATGGACAATAAAACTTGGGCTAAATCAGGAAGAGAAGACGCTCCAGAG
CTTAGAGCAAAAATGGATGAGTTATGGAATAAGTTATCTTCTAAAGAAGATGCAAGTGCT
CTTATAGAAGAGTTATATGGAGAGTTTGCAAGAATGGAAGAAGCTTGTAATAATCTAAAG
GCAAATTTACCTGAAGTTGCTTTAGAAGAATGCTCAAGACAACTTGATGAACTTATTACT
TTAGCTCAAGGGGATAAGGCTTCATTAGATATGATTGTAGCTCAATTAAATGAAGATACA
GAGGCTTATGAAAGTGCTAAAGAAATTGCACAAAATAAATTAAATACAGCCTTAAGTAGC
TTTGCAGTTATATCTGAAAAGGTTGCTCAATCATTTATACAAGAAGCTTTAAGTTTTGAT
TTAACATTAATAAATCCAAGAACAGTAAAGATAACAGCTTCATCTGAAGAGACTTCAGGG
GAAAATGCACCAGCTTCCTTTGCTTCAGATGGTGATATGAATACTTTCTGGCATAGTAAA
TGGTCATCACCTGCTCATGAAGGTCCTCATCATTTAACTTTAGAATTAGATAATGTATAT
GAAATAAATAAAGTTAAATATGCTCCAAGACAAGATAGTAAAAATGGAAGAATAACAGGG
TATAAAGTATCTGTTAGTTTAGATGGAGAAAACTTTACAGAAGTTAAAACTGGAACTTTA
GAAGATAATGCAGCTATTAAATTTATAGAATTTGATAGTGTTGATGCTAAATATGTAAGA
TTAGATGTTACAGATAGCGTTTCAGATCAAGCAAATGGTAGAGGAAAATTTGCTACTGCT
GCAGAGGTTAATGTTCATGGAAAGTTAAAAGAAGCTGCTGAGGTAACAGGAAGTGTATCT
CTTGAAGCTTTAGAGGAAGTTCAAGTTGGAGAAAACATAGAAGTTGGAGTAGGTATAGAC
GAATTAGTAAATGCAGAAGCTTTTGCTTATGATTTTACACTAAATTATGATGAAAATGCC
TTTGAATATGTAGAAGCAATTTCTGATGATGGAGTGTTTGTAAATGCTAAGAAAATAGAA
GACGGAAAGGTTAGAGTGCTTGTAAGTTCTTTAACTGGAGAACCATTGCCAGCTAAAGAA
GTTTTAGCTAAGGTTGTCCTAAGAGCAGAAGCTAAAACAGAAGGAAGCAATTTAAGCGTA
ACCAATTCATCAGTTGGAGATGGAGAAGGGTTAGTTCATGAGATTGCAGGAACTGAAAAA
ACAGTTAATATAATAGAAGGAACTAGTCCAGAAATTGTTGTAAATCCAGTAAGAGATTTT
AAAGCATCAGAAATAAATAAAAAGAATGTAACTGTAACTTGGACAGAACCAGAAACAACA
GAAGGCTTAGAAGGATATATTCTTTATAAGGATGGTAAAAAGGTAGCTGAAATAGGCAAG
GATGAAACTTCTTATACATTTAAAAAGTTAAATAGACATACAATCTATAACTTTAAGATT
GCAGCTAAATATTCAAATGGGGAAGTTTCAAGTAAAGAAAGCCTAACTTTAAGAACTGCA
AGATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8XL08
UniProtKB Entry NameOGA_CLOPE
GenBank Gene IDBA000016
General References
  1. Shimizu T, Ohtani K, Hirakawa H, Ohshima K, Yamashita A, Shiba T, Ogasawara N, Hattori M, Kuhara S, Hayashi H: Complete genome sequence of Clostridium perfringens, an anaerobic flesh-eater. Proc Natl Acad Sci U S A. 2002 Jan 22;99(2):996-1001. Epub 2002 Jan 15. [PubMed:11792842]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04699gamma-butyrolactoneexperimentalunknownDetails