6,7-dimethyl-8-ribityllumazine synthase
Details
- Name
- 6,7-dimethyl-8-ribityllumazine synthase
- Kind
- protein
- Synonyms
- 2.5.1.78
- DMRL synthase
- Gene Name
- ribH
- UniProtKB Entry
- O66529Swiss-Prot
- Organism
- Aquifex aeolicus (strain VF5)
- NCBI Taxonomy ID
- 224324
- Amino acid sequence
>lcl|BSEQ0011018|6,7-dimethyl-8-ribityllumazine synthase MQIYEGKLTAEGLRFGIVASRFNHALVDRLVEGAIDCIVRHGGREEDITLVRVPGSWEIP VAAGELARKEDIDAVIAIGVLIRGATPHFDYIASEVSKGLANLSLELRKPITFGVITADT LEQAIERAGTKHGNKGWEAALSAIEMANLFKSLR
- Number of residues
- 154
- Molecular Weight
- 16705.035
- Theoretical pI
- 6.11
- GO Classification
- Functions6,7-dimethyl-8-ribityllumazine synthase activity / transferase activityProcessesriboflavin biosynthetic processComponentsriboflavin synthase complex
- General Function
- Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin.
- Specific Function
- 6,7-dimethyl-8-ribityllumazine synthase activity
- Pfam Domain Function
- DMRL_synthase (PF00885)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0011019|6,7-dimethyl-8-ribityllumazine synthase (ribH) ATGCAAATTTACGAAGGGAAACTAACCGCTGAAGGGCTGAGGTTCGGTATAGTGGCTTCC AGGTTCAACCACGCACTCGTGGATAGACTAGTTGAGGGAGCTATAGACTGCATAGTAAGA CACGGGGGAAGGGAAGAAGACATAACGCTCGTTAGAGTGCCGGGCTCCTGGGAAATTCCC GTGGCTGCGGGAGAGCTTGCGAGAAAAGAGGACATAGACGCTGTGATAGCGATAGGAGTT CTAATAAGGGGGGCTACTCCCCACTTTGATTACATAGCCTCTGAAGTGTCAAAAGGGCTT GCGAACCTTTCCTTAGAACTGAGAAAACCCATAACCTTCGGTGTTATAACTGCGGACACC TTGGAGCAGGCGATAGAAAGGGCGGGAACAAAGCACGGGAATAAGGGCTGGGAAGCTGCA CTTTCCGCAATAGAAATGGCAAACTTATTTAAGAGTCTGAGATGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID O66529 UniProtKB Entry Name RISB_AQUAE GenBank Protein ID 2982869 GenBank Gene ID AE000657 PDB ID(s) 1HQK, 1NQU, 1NQV, 1NQW, 1NQX KEGG ID aae:aq_132 NCBI Gene ID 1192672 - General References
- Deckert G, Warren PV, Gaasterland T, Young WG, Lenox AL, Graham DE, Overbeek R, Snead MA, Keller M, Aujay M, Huber R, Feldman RA, Short JM, Olsen GJ, Swanson RV: The complete genome of the hyperthermophilic bacterium Aquifex aeolicus. Nature. 1998 Mar 26;392(6674):353-8. [Article]
- Haase I, Mortl S, Kohler P, Bacher A, Fischer M: Biosynthesis of riboflavin in archaea. 6,7-dimethyl-8-ribityllumazine synthase of Methanococcus jannaschii. Eur J Biochem. 2003 Mar;270(5):1025-32. [Article]
- Zhang X, Meining W, Fischer M, Bacher A, Ladenstein R: X-ray structure analysis and crystallographic refinement of lumazine synthase from the hyperthermophile Aquifex aeolicus at 1.6 A resolution: determinants of thermostability revealed from structural comparisons. J Mol Biol. 2001 Mar 9;306(5):1099-114. [Article]
- Zhang X, Meining W, Cushman M, Haase I, Fischer M, Bacher A, Ladenstein R: A structure-based model of the reaction catalyzed by lumazine synthase from Aquifex aeolicus. J Mol Biol. 2003 Apr 18;328(1):167-82. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 6,7-dioxo-5H-8-ribitylaminolumazine experimental unknown target Details 5-Nitroso-6-ribityl-amino-2,4(1H,3H)-pyrimidinedione experimental unknown target Details 3-(7-hydroxy-8-ribityllumazine-6-yl) propionic acid experimental unknown target Details