Phospholipase A1
Details
- Name
- Phospholipase A1
- Kind
- protein
- Synonyms
- 3.1.1.32
- Detergent-resistant phospholipase A
- DR-phospholipase A
- OM PLA
- OMPLA
- Outer membrane phospholipase A
- Phosphatidylcholine 1-acylhydrolase
- Gene Name
- pldA
- UniProtKB Entry
- P0A921Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0019218|Phospholipase A1 MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
- Number of residues
- 289
- Molecular Weight
- 33162.93
- Theoretical pI
- 4.96
- GO Classification
- Functions1-acyl-2-lysophosphatidylserine acylhydrolase activity / calcium ion binding / phosphatidylcholine 1-acylhydrolase activity / phosphatidylserine 1-acylhydrolase activity / phospholipase A2 activity / protein homodimerization activityProcesseslipid catabolic processComponentscell outer membrane / integral component of cell outer membrane / intrinsic component of cell outer membrane
- General Function
- Has broad substrate specificity including hydrolysis of phosphatidylcholine with phospholipase A2 (EC 3.1.1.4) and phospholipase A1 (EC 3.1.1.32) activities. Strong expression leads to outer membrane breakdown and cell death; is dormant in normal growing cells. Required for efficient secretion of bacteriocins.
- Specific Function
- 1-acyl-2-lysophosphatidylserine acylhydrolase activity
- Pfam Domain Function
- PLA1 (PF02253)
- Signal Regions
- 1-20
- Transmembrane Regions
- 53-65 85-99 106-118 129-148 151-164 174-186 189-198 217-223 226-234 242-250 256-265 275-286
- Cellular Location
- Cell outer membrane
- Gene sequence
>lcl|BSEQ0019219|Phospholipase A1 (pldA) ATGCGGACTCTGCAGGGCTGGTTGTTGCCGGTGTTTATGTTGCCTATGGCAGTATATGCA CAAGAGGCAACGGTGAAAGAGGTGCATGACGCGCCAGCGGTGCGTGGCAGTATTATCGCC AATATGCTGCAGGAGCATGACAATCCGTTCACGCTCTATCCTTATGACACCAACTACCTC ATTTACACCCAAACCAGCGATCTGAATAAAGAAGCGATTGCCAGTTACGACTGGGCGGAA AATGCGCGTAAGGATGAAGTAAAGTTTCAGTTGAGCCTGGCATTTCCGCTGTGGCGTGGG ATTTTAGGCCCGAACTCGGTGTTGGGTGCGTCTTATACGCAAAAATCCTGGTGGCAACTG TCCAATAGCGAAGAGTCTTCACCGTTTCGTGAAACCAACTACGAACCGCAATTGTTCCTC GGTTTTGCCACCGATTACCGTTTTGCAGGTTGGACGCTGCGCGATGTGGAGATGGGGTAT AACCACGACTCTAACGGGCGTTCCGACCCGACCTCCCGCAGCTGGAACCGCCTTTATACT CGCCTGATGGCAGAAAACGGTAACTGGCTGGTAGAAGTGAAGCCGTGGTATGTGGTGGGT AATACTGACGATAACCCGGATATCACCAAATATATGGGTTACTACCAGCTTAAAATCGGC TATCACCTCGGTGATGCGGTGCTCAGTGCGAAAGGACAGTACAACTGGAACACCGGCTAC GGCGGCGCGGAGTTAGGCTTAAGTTACCCGATCACCAAACATGTGCGCCTTTATACTCAG GTTTACAGCGGCTATGGCGAATCGCTCATCGACTATAACTTCAACCAGACCCGTGTCGGT GTGGGGGTTATGCTAAACGATTTGTTTTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A921 UniProtKB Entry Name PA1_ECOLI GenBank Protein ID 757840 GenBank Gene ID X02143 PDB ID(s) 1FW2, 1FW3, 1ILD, 1ILZ, 1IM0, 1QD5, 1QD6 KEGG ID ecj:JW3794 NCBI Gene ID 948307 - General References
- Homma H, Kobayashi T, Chiba N, Karasawa K, Mizushima H, Kudo I, Inoue K, Ikeda H, Sekiguchi M, Nojima S: The DNA sequence encoding pldA gene, the structural gene for detergent-resistant phospholipase A of E. coli. J Biochem. 1984 Dec;96(6):1655-64. [Article]
- Daniels DL, Plunkett G 3rd, Burland V, Blattner FR: Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. Science. 1992 Aug 7;257(5071):771-8. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Dekker N, Merck K, Tommassen J, Verheij HM: In vitro folding of Escherichia coli outer-membrane phospholipase A. Eur J Biochem. 1995 Aug 15;232(1):214-9. [Article]
- de Geus P, Verheij HM, Riegman NH, Hoekstra WP, de Haas GH: The pro- and mature forms of the E. coli K-12 outer membrane phospholipase A are identical. EMBO J. 1984 Aug;3(8):1799-802. [Article]
- Irino N, Nakayama K, Nakayama H: The recQ gene of Escherichia coli K12: primary structure and evidence for SOS regulation. Mol Gen Genet. 1986 Nov;205(2):298-304. [Article]
- Homma H, Chiba N, Kobayashi T, Kudo I, Inoue K, Ikeda H, Sekiguchi M, Nojima S: Characteristics of detergent-resistant phospholipase A overproduced in E. coli cells bearing its cloned structural gene. J Biochem. 1984 Dec;96(6):1645-53. [Article]
- Brok RG, Brinkman E, van Boxtel R, Bekkers AC, Verheij HM, Tommassen J: Molecular characterization of enterobacterial pldA genes encoding outer membrane phospholipase A. J Bacteriol. 1994 Feb;176(3):861-70. [Article]
- Horrevoets AJ, Verheij HM, de Haas GH: Inactivation of Escherichia coli outer-membrane phospholipase A by the affinity label hexadecanesulfonyl fluoride. Evidence for an active-site serine. Eur J Biochem. 1991 May 23;198(1):247-53. [Article]
- Dekker N, Tommassen J, Lustig A, Rosenbusch JP, Verheij HM: Dimerization regulates the enzymatic activity of Escherichia coli outer membrane phospholipase A. J Biol Chem. 1997 Feb 7;272(6):3179-84. [Article]
- Dekker N, Tommassen J, Verheij HM: Bacteriocin release protein triggers dimerization of outer membrane phospholipase A in vivo. J Bacteriol. 1999 May;181(10):3281-3. [Article]
- Snijder HJ, Ubarretxena-Belandia I, Blaauw M, Kalk KH, Verheij HM, Egmond MR, Dekker N, Dijkstra BW: Structural evidence for dimerization-regulated activation of an integral membrane phospholipase. Nature. 1999 Oct 14;401(6754):717-21. [Article]
- Snijder HJ, Kingma RL, Kalk KH, Dekker N, Egmond MR, Dijkstra BW: Structural investigations of calcium binding and its role in activity and activation of outer membrane phospholipase A from Escherichia coli. J Mol Biol. 2001 Jun 1;309(2):477-89. [Article]
- Snijder HJ, Van Eerde JH, Kingma RL, Kalk KH, Dekker N, Egmond MR, Dijkstra BW: Structural investigations of the active-site mutant Asn156Ala of outer membrane phospholipase A: function of the Asn-His interaction in the catalytic triad. Protein Sci. 2001 Oct;10(10):1962-9. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 1-Hexadecanosulfonyl-O-L-Serine experimental unknown target Details