Granulocyte-macrophage colony-stimulating factor

Details

Name
Granulocyte-macrophage colony-stimulating factor
Kind
protein
Synonyms
  • Colony-stimulating factor
  • CSF
  • GM-CSF
  • GMCSF
  • Molgramostin
  • Sargramostim
Gene Name
CSF2
UniProtKB Entry
P04141Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0011774|Granulocyte-macrophage colony-stimulating factor
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
Number of residues
144
Molecular Weight
16294.605
Theoretical pI
4.93
GO Classification
Functions
cytokine activity / growth factor activity
Processes
cell population proliferation / cell surface receptor signaling pathway via JAK-STAT / cellular response to granulocyte macrophage colony-stimulating factor stimulus / granulocyte-macrophage colony-stimulating factor signaling pathway / histamine secretion / immune response / macrophage differentiation / monocyte differentiation / myeloid cell differentiation / negative regulation of DNA-templated transcription / neutrophil differentiation / positive regulation of cell migration / positive regulation of cell population proliferation / positive regulation of leukocyte proliferation / positive regulation of tyrosine phosphorylation of STAT protein / regulation of circadian sleep/wake cycle, sleep / response to fluid shear stress / response to silicon dioxide
Components
granulocyte macrophage colony-stimulating factor receptor complex / intracellular membrane-bounded organelle / plasma membrane
General Function
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes
Specific Function
cytokine activity
Pfam Domain Function
Signal Regions
1-17
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0011775|Granulocyte-macrophage colony-stimulating factor (CSF2)
ATGTGGCTGCAGAGCCTGCTGCTCTTGGGCACTGTGGCCTGCAGCATCTCTGCACCCGCC
CGCTCGCCCAGCCCCAGCACGCAGCCCTGGGAGCATGTGAATGCCATCCAGGAGGCCCGG
CGTCTCCTGAACCTGAGTAGAGACACTGCTGCTGAGATGAATGAAACAGTAGAAGTCATC
TCAGAAATGTTTGACCTCCAGGAGCCGACCTGCCTACAGACCCGCCTGGAGCTGTACAAG
CAGGGCCTGCGGGGCAGCCTCACCAAGCTCAAGGGCCCCTTGACCATGATGGCCAGCCAC
TACAAGCAGCACTGCCCTCCAACCCCGGAAACTTCCTGTGCAACCCAGATTATCACCTTT
GAAAGTTTCAAAGAGAACCTGAAGGACTTTCTGCTTGTCATCCCCTTTGACTGCTGGGAG
CCAGTCCAGGAGTGA
Chromosome Location
5
Locus
5q31.1
External Identifiers
ResourceLink
UniProtKB IDP04141
UniProtKB Entry NameCSF2_HUMAN
GenBank Gene IDM13207
GeneCard IDCSF2
GenAtlas IDCSF2
HGNC IDHGNC:2434
PDB ID(s)1CSG, 2GMF, 4NKQ, 4RS1, 5C7X, 5D70, 5D71, 5D72, 6BFQ, 6BFS
KEGG IDhsa:1437
NCBI Gene ID1437
General References
  1. Lee F, Yokota T, Otsuka T, Gemmell L, Larson N, Luh J, Arai K, Rennick D: Isolation of cDNA for a human granulocyte-macrophage colony-stimulating factor by functional expression in mammalian cells. Proc Natl Acad Sci U S A. 1985 Jul;82(13):4360-4. [Article]
  2. Kaushansky K, O'Hara PJ, Berkner K, Segal GM, Hagen FS, Adamson JW: Genomic cloning, characterization, and multilineage growth-promoting activity of human granulocyte-macrophage colony-stimulating factor. Proc Natl Acad Sci U S A. 1986 May;83(10):3101-5. [Article]
  3. Cantrell MA, Anderson D, Cerretti DP, Price V, McKereghan K, Tushinski RJ, Mochizuki DY, Larsen A, Grabstein K, Gillis S, et al.: Cloning, sequence, and expression of a human granulocyte/macrophage colony-stimulating factor. Proc Natl Acad Sci U S A. 1985 Sep;82(18):6250-4. [Article]
  4. Wong GG, Witek JS, Temple PA, Wilkens KM, Leary AC, Luxenberg DP, Jones SS, Brown EL, Kay RM, Orr EC, et al.: Human GM-CSF: molecular cloning of the complementary DNA and purification of the natural and recombinant proteins. Science. 1985 May 17;228(4701):810-5. [Article]
  5. Miyatake S, Otsuka T, Yokota T, Lee F, Arai K: Structure of the chromosomal gene for granulocyte-macrophage colony stimulating factor: comparison of the mouse and human genes. EMBO J. 1985 Oct;4(10):2561-8. [Article]
  6. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. Kaushansky K, Lopez JA, Brown CB: Role of carbohydrate modification in the production and secretion of human granulocyte macrophage colony-stimulating factor in genetically engineered and normal mesenchymal cells. Biochemistry. 1992 Feb 18;31(6):1881-6. [Article]
  9. Diederichs K, Boone T, Karplus PA: Novel fold and putative receptor binding site of granulocyte-macrophage colony-stimulating factor. Science. 1991 Dec 20;254(5039):1779-82. [Article]
  10. Walter MR, Cook WJ, Ealick SE, Nagabhushan TL, Trotta PP, Bugg CE: Three-dimensional structure of recombinant human granulocyte-macrophage colony-stimulating factor. J Mol Biol. 1992 Apr 20;224(4):1075-85. [Article]
  11. Hansen G, Hercus TR, McClure BJ, Stomski FC, Dottore M, Powell J, Ramshaw H, Woodcock JM, Xu Y, Guthridge M, McKinstry WJ, Lopez AF, Parker MW: The structure of the GM-CSF receptor complex reveals a distinct mode of cytokine receptor activation. Cell. 2008 Aug 8;134(3):496-507. doi: 10.1016/j.cell.2008.05.053. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
KB002investigationalunknowntargetDetails