Endoribonuclease EndoA

Details

Name
Endoribonuclease EndoA
Kind
protein
Synonyms
  • 3.1.27.-
  • mazF
  • MazF-bs
  • mRNA interferase EndoA
  • mRNA interferase MazF-bs
  • Toxin EndoA
  • ydcE
Gene Name
ndoA
UniProtKB Entry
P96622Swiss-Prot
Organism
Bacillus subtilis (strain 168)
NCBI Taxonomy ID
224308
Amino acid sequence
>lcl|BSEQ0011904|Endoribonuclease EndoA
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHV
EIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Number of residues
116
Molecular Weight
12977.845
Theoretical pI
4.88
GO Classification
Functions
DNA binding / endonuclease activity / RNA binding
General Function
Toxic component of a type II toxin-antitoxin (TA) system. Specific for 5'-UACAU-3' sequences, cleaving after the first U (PubMed:21763692). Yields cleavage products with 3' phosphate and 5' hydroxyl groups (PubMed:15882409). Cannot digest substrate with a UUdUACAUAA cleavage site (PubMed:24120662). Overexpression is toxic for cell growth (shown in E.coli), probably by inhibiting protein synthesis through the cleavage of single-stranded RNA. The toxicity is reversed by the antitoxin EndoAI. Toxin activity cannot be inhibited by MazE from E.coli. The EndoA-EndoAI complex does not seem to bind its own promoter (PubMed:24120662).
Specific Function
DNA binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0011905|Endoribonuclease EndoA (ndoA)
TTGATTGTGAAACGCGGCGATGTTTATTTTGCTGATTTATCTCCTGTTGTTGGCTCAGAG
CAAGGCGGGGTGCGCCCGGTTTTAGTGATCCAAAATGACATCGGAAATCGCTTCAGCCCA
ACTGCTATTGTTGCAGCCATAACAGCACAAATACAGAAAGCGAAATTACCAACCCACGTC
GAAATCGATGCAAAACGCTACGGTTTTGAAAGAGATTCCGTTATTTTGCTGGAGCAAATT
CGGACGATTGACAAGCAAAGGTTAACGGATAAGATTACTCATCTGGATGATGAAATGATG
GATAAGGTTGATGAAGCCTTACAAATCAGTTTGGCACTCATTGATTTTTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP96622
UniProtKB Entry NameENDOA_BACSU
GenBank Gene IDAB001488
PDB ID(s)1NE8, 4MDX, 4ME7
KEGG IDbsu:BSU04660
NCBI Gene ID939935
General References
  1. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
  2. Pellegrini O, Mathy N, Gogos A, Shapiro L, Condon C: The Bacillus subtilis ydcDE operon encodes an endoribonuclease of the MazF/PemK family and its inhibitor. Mol Microbiol. 2005 Jun;56(5):1139-48. [Article]
  3. Park JH, Yamaguchi Y, Inouye M: Bacillus subtilis MazF-bs (EndoA) is a UACAU-specific mRNA interferase. FEBS Lett. 2011 Aug 4;585(15):2526-32. doi: 10.1016/j.febslet.2011.07.008. Epub 2011 Jul 13. [Article]
  4. Ishida Y, Park JH, Mao L, Yamaguchi Y, Inouye M: Replacement of all arginine residues with canavanine in MazF-bs mRNA interferase changes its specificity. J Biol Chem. 2013 Mar 15;288(11):7564-71. doi: 10.1074/jbc.M112.434969. Epub 2013 Feb 1. [Article]
  5. Gogos A, Mu H, Bahna F, Gomez CA, Shapiro L: Crystal structure of YdcE protein from Bacillus subtilis. Proteins. 2003 Nov 1;53(2):320-2. [Article]
  6. Simanshu DK, Yamaguchi Y, Park JH, Inouye M, Patel DJ: Structural basis of mRNA recognition and cleavage by toxin MazF and its regulation by antitoxin MazE in Bacillus subtilis. Mol Cell. 2013 Nov 7;52(3):447-58. doi: 10.1016/j.molcel.2013.09.006. Epub 2013 Oct 10. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
2-(2-{2-[2-(2-Methoxy-Ethoxy)-Ethoxy]-Ethoxy}-Ethoxy)-EthanolexperimentalunknowntargetDetails