Immunoglobulin heavy constant gamma 2
Details
- Name
- Immunoglobulin heavy constant gamma 2
- Kind
- protein
- Synonyms
- Ig gamma-2 chain C region
- Ig gamma-2 chain C region DOT
- Ig gamma-2 chain C region TIL
- Ig gamma-2 chain C region ZIE
- Gene Name
- IGHG2
- UniProtKB Entry
- P01859Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055469|Immunoglobulin heavy constant gamma 2 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCY SATITFFKVKWIFSSVVDLKQTIVPDYRNMIRQGA
- Number of residues
- 395
- Molecular Weight
- 43805.48
- Theoretical pI
- 7.66
- GO Classification
- Processesadaptive immune response / antibacterial humoral responseComponentsIgG immunoglobulin complex / plasma membrane
- General Function
- Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
- Specific Function
- antigen binding
- Pfam Domain Function
- C1-set (PF07654)
- Signal Regions
- Not Available
- Transmembrane Regions
- 347-367
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- 14q32.33
- External Identifiers
Resource Link UniProtKB ID P01859 UniProtKB Entry Name IGHG2_HUMAN GenBank Gene ID AL928742 GeneCard ID IGHG2 HGNC ID HGNC:5526 PDB ID(s) 2QSC, 4HAF, 4HAG, 4L4J, 7LUS - General References
- Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
- Ellison J, Hood L: Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes. Proc Natl Acad Sci U S A. 1982 Mar;79(6):1984-8. [Article]
- Takahashi N, Ueda S, Obata M, Nikaido T, Nakai S, Honjo T: Structure of human immunoglobulin gamma genes: implications for evolution of a gene family. Cell. 1982 Jun;29(2):671-9. [Article]
- Krawinkel U, Rabbitts TH: Comparison of the hinge-coding segments in human immunoglobulin gamma heavy chain genes and the linkage of the gamma 2 and gamma 4 subclass genes. EMBO J. 1982;1(4):403-7. [Article]
- Wang AC, Tung E, Fudenberg HH: The primary structure of a human IgG2 heavy chain: genetic, evolutionary, and functional implications. J Immunol. 1980 Sep;125(3):1048-54. [Article]
- Connell GE, Parr DM, Hofmann T: The amino acid sequences of the three heavy chain constant region domains of a human IgG2 myeloma protein. Can J Biochem. 1979 Jun;57(6):758-67. [Article]
- Hofmann T, Parr DM: A note of the amino acid sequence of residues 381--391 of human immunoglobulins gamma chains. Mol Immunol. 1979 Nov;16(11):923-5. [Article]
- Stoppini M, Bellotti V, Negri A, Merlini G, Garver F, Ferri G: Characterization of the two unique human anti-flavin monoclonal immunoglobulins. Eur J Biochem. 1995 Mar 15;228(3):886-93. [Article]
- Milstein C, Frangione B: Disulphide bridges of the heavy chain of human immunoglobulin G2. Biochem J. 1971 Jan;121(2):217-25. [Article]
- Frangione B, Milstein C, Pink JR: Structural studies of immunoglobulin G. Nature. 1969 Jan 11;221(5176):145-8. [Article]
- Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 1-[N-4'-NITROBENZYL-N-4'-CARBOXYBUTYLAMINO]METHYLPHOSPHONIC ACID experimental unknown target Details Aetiocholanolone experimental unknown target Details Etiocholanedione experimental unknown target Details Methylecgonine experimental unknown target Details 3-OXO-N-[(3S)-2-OXOPYRROLIDIN-3-YL]DODECANAMIDE experimental unknown target Details 4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE experimental unknown target Details 5-ALPHA-PREGNANE-3-BETA-OL-HEMISUCCINATE experimental unknown target Details PROGESTERONE-11-ALPHA-OL-HEMISUCCINATE experimental unknown target Details 3-(HYDROXY-PHENYL-PHOSPHINOYLOXY)-8-METHYL-8-AZA-BICYCLO[3.2.1]OCTANE-2-CARBOXYLIC ACID METHYL ESTER experimental unknown target Details