Immunoglobulin kappa variable 2-30
Details
- Name
- Immunoglobulin kappa variable 2-30
- Kind
- protein
- Synonyms
- Ig kappa chain V-II region RPMI 6410
- Gene Name
- IGKV2-30
- UniProtKB Entry
- P06310Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0064679|Immunoglobulin kappa variable 2-30 MRLPAQLLGLLMLWVPGSSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNW FQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP
- Number of residues
- 120
- Molecular Weight
- 13184.875
- Theoretical pI
- 9.53
- GO Classification
- Processesadaptive immune responseComponentsextracellular space / immunoglobulin complex
- General Function
- V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
- Specific Function
- antigen binding
- Pfam Domain Function
- Not Available
- Signal Regions
- 1-20
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P06310 UniProtKB Entry Name KV230_HUMAN GenBank Protein ID 296655 GenBank Gene ID Z00020 GeneCard ID IGKV2-30 HGNC ID HGNC:5785 - General References
- Klobeck HG, Meindl A, Combriato G, Solomon A, Zachau HG: Human immunoglobulin kappa light chain genes of subgroups II and III. Nucleic Acids Res. 1985 Sep 25;13(18):6499-513. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Fluorescein approved no target other Details Etiocholanedione experimental unknown target Details