Lipoprotein MxiM
Details
- Name
- Lipoprotein MxiM
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- mxiM
- UniProtKB Entry
- P0A1X2Swiss-Prot
- Organism
- Shigella flexneri
- NCBI Taxonomy ID
- 623
- Amino acid sequence
>lcl|BSEQ0007843|Lipoprotein MxiM MIRHGSNKLKIFILSILLLTLSGCALKSSSNSEKEWHIVPVSKDYFSIPNDLLWSFNTTN KSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGN KINDTILIEKDGEVKLKLIRGI
- Number of residues
- 142
- Molecular Weight
- 15852.475
- Theoretical pI
- 9.9
- GO Classification
- ProcessespathogenesisComponentscell outer membrane
- General Function
- Involved in the synthesis of the type III secretion system (T3SS), also called injectisome, which is used to inject bacterial effector proteins into eukaryotic host cells (PubMed:10085046, PubMed:11717255). Pilot protein that is required for the proper localization of the secretin MxiD/SctC in the outer membrane (PubMed:11717255). Also influences both MxiD/SctC multimerization and stability (PubMed:11717255). Required for both Ipa translocation and tissue culture cell invasion (PubMed:10085046). Binds lipids (PubMed:15775974).
- Specific Function
- Not Available
- Pfam Domain Function
- MxiM (PF11441)
- Signal Regions
- 1-23
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell outer membrane
- Gene sequence
>lcl|BSEQ0020739|Lipoprotein MxiM (mxiM) ATGATTCGACATGGTAGTAATAAGTTGAAAATATTTATTTTAAGTATATTGCTATTAACA CTGAGTGGGTGTGCTTTAAAGTCATCATCTAATTCTGAAAAAGAATGGCATATTGTTCCT GTAAGTAAGGATTATTTTTCTATTCCAAATGATTTATTATGGTCGTTTAATACAACCAAT AAAAGTATAAATGTTTACTCTAAATGTATTAGTGGTAAGGCGGTTTATAGTTTTAATGCA GGTAAATTCATGGGCAACTTTAATGTTAAGGAAGTAGATGGGTGCTTCATGGATGCACAA AAGATAGCTATAGATAAACTATTTTCTATGCTGAAAGACGGGGTTGTTTTAAAAGGTAAT AAGATAAATGATACCATCCTTATAGAGAAGGATGGGGAAGTTAAATTAAAATTAATTCGA GGGATATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A1X2 UniProtKB Entry Name MXIM_SHIFL GenBank Protein ID 152770 GenBank Gene ID M98391 PDB ID(s) 1Y9L, 1Y9T, 2JW1 KEGG ID sfl:CP0143 NCBI Gene ID 1238028 - General References
- Allaoui A, Sansonetti PJ, Parsot C: MxiJ, a lipoprotein involved in secretion of Shigella Ipa invasins, is homologous to YscJ, a secretion factor of the Yersinia Yop proteins. J Bacteriol. 1992 Dec;174(23):7661-9. [Article]
- Buchrieser C, Glaser P, Rusniok C, Nedjari H, D'Hauteville H, Kunst F, Sansonetti P, Parsot C: The virulence plasmid pWR100 and the repertoire of proteins secreted by the type III secretion apparatus of Shigella flexneri. Mol Microbiol. 2000 Nov;38(4):760-71. [Article]
- Venkatesan MM, Goldberg MB, Rose DJ, Grotbeck EJ, Burland V, Blattner FR: Complete DNA sequence and analysis of the large virulence plasmid of Shigella flexneri. Infect Immun. 2001 May;69(5):3271-85. [Article]
- Lan R, Stevenson G, Reeves PR: Comparison of two major forms of the Shigella virulence plasmid pINV: positive selection is a major force driving the divergence. Infect Immun. 2003 Nov;71(11):6298-306. [Article]
- Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J, Yang F, Zhang X, Zhang J, Yang G, Wu H, Qu D, Dong J, Sun L, Xue Y, Zhao A, Gao Y, Zhu J, Kan B, Ding K, Chen S, Cheng H, Yao Z, He B, Chen R, Ma D, Qiang B, Wen Y, Hou Y, Yu J: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157. Nucleic Acids Res. 2002 Oct 15;30(20):4432-41. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 1-Monohexanoyl-2-Hydroxy-Sn-Glycero-3-Phosphate experimental unknown target Details