Mannose-binding protein C

Details

Name

Mannose-binding protein C

Kind

protein

Synonyms

• COLEC1
• Collectin-1
• Mannan-binding protein
• Mannose-binding lectin
• MBL
• MBP-C
• MBP1

Gene Name

MBL2

UniProtKB Entry

P11226Swiss-Prot

Organism

Humans

NCBI Taxonomy ID

9606

Amino acid sequence

>lcl|BSEQ0013136|Mannose-binding protein C
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI

Number of residues

248

Molecular Weight

26143.345

Theoretical pI

Not Available

GO Classification

Functions

D-mannose binding / identical protein binding / signaling receptor binding

Processes

antiviral innate immune response / cell surface pattern recognition receptor signaling pathway / positive regulation of opsonization / proteolysis / surfactant homeostasis

Components

external side of plasma membrane / multivesicular body / serine-type endopeptidase complex

General Function

Calcium-dependent lectin involved in innate immune defense (PubMed:35102342). Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA. Upon SARS coronavirus-2/SARS-CoV-2 infection, activates the complement lectin pathway which leads to the inhibition SARS-CoV-2 infection and a reduction of the induced inflammatory response (PubMed:35102342)

Specific Function

calcium-dependent protein binding

Pfam Domain Function

• Collagen (PF01391)
• Lectin_C (PF00059)

Signal Regions

1-20

Transmembrane Regions

Not Available

Cellular Location

Secreted

Gene sequence

>lcl|BSEQ0013137|Mannose-binding protein C (MBL2)
ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCA
GAAACTGTGACCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCT
CCAGGCATCAACGGCTTCCCAGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGG
GAACCAGGCCAAGGGCTCAGAGGCTTACAGGGCCCCCCTGGAAAGTTGGGGCCTCCAGGA
AATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAAAAGGAGACCCTGGAAAAAGT
CCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAACAGAAATGGCA
CGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTG
ACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCC
TCTGTGGCCACCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAG
GAAGCCTTCCTGGGCATCACTGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGA
AATAGACTGACCTACACAAACTGGAACGAGGGTGAACCCAACAATGCTGGTTCTGATGAA
GATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACGTCCCCTGCTCCACCTCCCAT
CTGGCCGTCTGTGAGTTCCCTATCTGA

Chromosome Location

10

Locus

10q21.1

External Identifiers

Resource	Link
UniProtKB ID	P11226
UniProtKB Entry Name	MBL2_HUMAN
GeneCard ID	MBL2
HGNC ID	HGNC:6922
PDB ID(s)	1HUP
KEGG ID	hsa:4153
NCBI Gene ID	4153

General References

1. Ezekowitz RA, Day LE, Herman GA: A human mannose-binding protein is an acute-phase reactant that shares sequence homology with other vertebrate lectins. J Exp Med. 1988 Mar 1;167(3):1034-46. [Article]
2. Sastry K, Herman GA, Day L, Deignan E, Bruns G, Morton CC, Ezekowitz RA: The human mannose-binding protein gene. Exon structure reveals its evolutionary relationship to a human pulmonary surfactant gene and localization to chromosome 10. J Exp Med. 1989 Oct 1;170(4):1175-89. [Article]
3. Taylor ME, Brickell PM, Craig RK, Summerfield JA: Structure and evolutionary origin of the gene encoding a human serum mannose-binding protein. Biochem J. 1989 Sep 15;262(3):763-71. [Article]
4. Madsen HO, Satz ML, Hogh B, Svejgaard A, Garred P: Different molecular events result in low protein levels of mannan-binding lectin in populations from southeast Africa and South America. J Immunol. 1998 Sep 15;161(6):3169-75. [Article]
5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
6. Juliger S, Kremsner PG, Alpers MP, Reeder JC, Kun JF: Restricted polymorphisms of the mannose-binding lectin gene in a population of Papua New Guinea. Mutat Res. 2002 Aug 29;505(1-2):87-91. [Article]
7. Kurata H, Sannoh T, Kozutsumi Y, Yokota Y, Kawasaki T: Structure and function of mannan-binding proteins isolated from human liver and serum. J Biochem. 1994 Jun;115(6):1148-54. [Article]
8. Thiel S, Vorup-Jensen T, Stover CM, Schwaeble W, Laursen SB, Poulsen K, Willis AC, Eggleton P, Hansen S, Holmskov U, Reid KB, Jensenius JC: A second serine protease associated with mannan-binding lectin that activates complement. Nature. 1997 Apr 3;386(6624):506-10. [Article]
9. Nauta AJ, Raaschou-Jensen N, Roos A, Daha MR, Madsen HO, Borrias-Essers MC, Ryder LP, Koch C, Garred P: Mannose-binding lectin engagement with late apoptotic and necrotic cells. Eur J Immunol. 2003 Oct;33(10):2853-63. [Article]
10. Palaniyar N, Nadesalingam J, Clark H, Shih MJ, Dodds AW, Reid KB: Nucleic acid is a novel ligand for innate, immune pattern recognition collectins surfactant proteins A and D and mannose-binding lectin. J Biol Chem. 2004 Jul 30;279(31):32728-36. Epub 2004 May 15. [Article]
11. Hirano M, Ma BY, Kawasaki N, Okimura K, Baba M, Nakagawa T, Miwa K, Kawasaki N, Oka S, Kawasaki T: Mannan-binding protein blocks the activation of metalloproteases meprin alpha and beta. J Immunol. 2005 Sep 1;175(5):3177-85. [Article]
12. Hummelshoj T, Fog LM, Madsen HO, Sim RB, Garred P: Comparative study of the human ficolins reveals unique features of Ficolin-3 (Hakata antigen). Mol Immunol. 2008 Mar;45(6):1623-32. Epub 2007 Nov 19. [Article]
13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
14. Sheriff S, Chang CY, Ezekowitz RA: Human mannose-binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil. Nat Struct Biol. 1994 Nov;1(11):789-94. [Article]
15. Sumiya M, Super M, Tabona P, Levinsky RJ, Arai T, Turner MW, Summerfield JA: Molecular basis of opsonic defect in immunodeficient children. Lancet. 1991 Jun 29;337(8757):1569-70. [Article]
16. Lipscombe RJ, Sumiya M, Hill AV, Lau YL, Levinsky RJ, Summerfield JA, Turner MW: High frequencies in African and non-African populations of independent mutations in the mannose binding protein gene. Hum Mol Genet. 1992 Dec;1(9):709-15. [Article]
17. Super M, Gillies SD, Foley S, Sastry K, Schweinle JE, Silverman VJ, Ezekowitz RA: Distinct and overlapping functions of allelic forms of human mannose binding protein. Nat Genet. 1992 Sep;2(1):50-5. [Article]
18. Gabolde M, Muralitharan S, Besmond C: Genotyping of the three major allelic variants of the human mannose-binding lectin gene by denaturing gradient gel electrophoresis. Hum Mutat. 1999;14(1):80-3. [Article]
19. Thio CL, Mosbruger T, Astemborski J, Greer S, Kirk GD, O'Brien SJ, Thomas DL: Mannose binding lectin genotypes influence recovery from hepatitis B virus infection. J Virol. 2005 Jul;79(14):9192-6. [Article]
20. Thye T, Niemann S, Walter K, Homolka S, Intemann CD, Chinbuah MA, Enimil A, Gyapong J, Osei I, Owusu-Dabo E, Rusch-Gerdes S, Horstmann RD, Ehlers S, Meyer CG: Variant G57E of mannose binding lectin associated with protection against tuberculosis caused by Mycobacterium africanum but not by M. tuberculosis. PLoS One. 2011;6(6):e20908. doi: 10.1371/journal.pone.0020908. Epub 2011 Jun 10. [Article]

Associated Data

Drug Relations

Drug	Drug group	Pharmacological action?	Type	Actions	Details
O3-Sulfonylgalactose	experimental	unknown	target		Details
Methyl alpha-D-mannoside	experimental	unknown	target		Details
4-(Hydrogen sulfate)-beta-D-galactopyranose	experimental	unknown	target		Details
Methyl beta-L-fucopyranoside	experimental	unknown	target		Details
N-acetyl-alpha-neuraminic acid	experimental	unknown	target		Details
alpha-L-methyl-fucose	experimental	unknown	target		Details
Alpha-Methyl-N-Acetyl-D-Glucosamine	experimental	unknown	target		Details