Interleukin-12 subunit alpha
Details
- Name
- Interleukin-12 subunit alpha
- Kind
- protein
- Synonyms
- CLMF p35
- Cytotoxic lymphocyte maturation factor 35 kDa subunit
- IL-12 subunit p35
- IL-12A
- NK cell stimulatory factor chain 1
- NKSF1
- Gene Name
- IL12A
- UniProtKB Entry
- P29459Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0049311|Interleukin-12 subunit alpha MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
- Number of residues
- 219
- Molecular Weight
- 24873.72
- Theoretical pI
- Not Available
- GO Classification
- Functionscytokine activity / growth factor activity / interleukin-12 beta subunit binding / interleukin-12 receptor binding / interleukin-27 binding / protein heterodimerization activityProcessescell migration / cellular response to virus / defense response to Gram-positive bacterium / extrinsic apoptotic signaling pathway / immune response / interleukin-12-mediated signaling pathway / negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis / negative regulation of interleukin-17 production / negative regulation of protein secretion / negative regulation of smooth muscle cell proliferation / negative regulation of vascular endothelial growth factor signaling pathway / positive regulation of cell adhesion / positive regulation of dendritic cell chemotaxis / positive regulation of lymphocyte proliferation / positive regulation of mononuclear cell proliferation / positive regulation of natural killer cell activation / positive regulation of natural killer cell mediated cytotoxicity / positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target / positive regulation of NK T cell activation / positive regulation of smooth muscle cell apoptotic process / positive regulation of T cell mediated cytotoxicity / positive regulation of type II interferon production / positive regulation of tyrosine phosphorylation of STAT protein / response to lipopolysaccharide / response to UV-B / response to virusComponentsendoplasmic reticulum lumen / extracellular region / extracellular space / interleukin-12 complex / late endosome lumen
- General Function
- Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine (PubMed:8605935, PubMed:8943050). IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes and regulates T-cell and natural killer-cell responses, induces the production of interferon-gamma (IFN-gamma), favors the differentiation of T-helper 1 (Th1) cells and is an important link between innate resistance and adaptive immunity (PubMed:1673147, PubMed:1674604, PubMed:8605935). Mechanistically, exerts its biological effects through a receptor composed of IL12R1 and IL12R2 subunits (PubMed:8943050). Binding to the receptor results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2 (PubMed:7528775). In turn, recruited STAT4 gets phosphorylated and translocates to the nucleus where it regulates cytokine/growth factor responsive genes (PubMed:7638186). As part of IL-35, plays essential roles in maintaining the immune homeostasis of the liver microenvironment and functions also as an immune-suppressive cytokine (By similarity). Mediates biological events through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers (PubMed:22306691). Signaling requires the transcription factors STAT1 and STAT4, which form a unique heterodimer that binds to distinct DNA sites (PubMed:22306691)
- Specific Function
- cytokine activity
- Pfam Domain Function
- IL12 (PF03039)
- Signal Regions
- 1-22
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- 3
- Locus
- 3q25.33
- External Identifiers
Resource Link UniProtKB ID P29459 UniProtKB Entry Name IL12A_HUMAN GeneCard ID IL12A HGNC ID HGNC:5969 PDB ID(s) 1F45, 3HMX KEGG ID hsa:3592 NCBI Gene ID 3592 - General References
- Not Available