Fatty acid desaturase 1

Details

Name
Fatty acid desaturase 1
Synonyms
  • 1.14.19.-
  • D5D
  • Delta-5 desaturase
  • Delta(5) desaturase
  • Delta(5) fatty acid desaturase
  • FADSD5
Gene Name
FADS1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001770|Fatty acid desaturase 1
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVIS
HYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVE
RMGLMKANHVFFLLYLLHILLLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHD
FGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFA
LGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVIQRKKWVDLAWMI
TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQL
QATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
SAFADIIHSLKESGQLWLDAYLHQ
Number of residues
444
Molecular Weight
51963.945
Theoretical pI
9.15
GO Classification
Functions
C-5 sterol desaturase activity / oxidoreductase activity
Processes
alpha-linolenic acid metabolic process / cell-cell signaling / cellular lipid metabolic process / cellular response to starvation / icosanoid biosynthetic process / linoleic acid metabolic process / phospholipid biosynthetic process / regulation of cell differentiation / regulation of transcription, DNA-templated / small molecule metabolic process / unsaturated fatty acid biosynthetic process / unsaturated fatty acid metabolic process
Components
endoplasmic reticulum membrane / integral component of membrane / intracellular membrane-bounded organelle / membrane / mitochondrion
General Function
Oxidoreductase activity
Specific Function
Isoform 2 does not exhibit any catalytic activity toward 20:3n-6, but it may enhance FADS2 activity (By similarity). Isoform 1 is a component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3), respectively.
Pfam Domain Function
Transmembrane Regions
122-142 146-170 268-288 306-326
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0010626|Fatty acid desaturase 1 (FADS1)
ATGGGAACGCGCGCTGCGAGGCCCGCCGGTCTGCCCTGCGGTGCTGAAAACCCGGCGCGC
AGGCGGCTGGCTCTGGGCGCGCGCCAGCAAATCCACTCCTGGAGCCCGCGGACCCCGAGC
ACGCGCCTGACAGCCCCTGCTGGCCCGGCGCGCGGCGTCGCCAGGCCAGCTATGGCCCCC
GACCCGGTGGCCGCCGAGACCGCGGCTCAGGGACCTACCCCGCGCTACTTCACCTGGGAC
GAGGTGGCCCAGCGCTCAGGGTGCGAGGAGCGGTGGCTAGTGATCGACCGTAAGGTGTAC
AACATCAGCGAGTTCACCCGCCGGCATCCAGGGGGCTCCCGGGTCATCAGCCACTACGCC
GGGCAGGATGCCACGGATCCCTTTGTGGCCTTCCACATCAACAAGGGCCTTGTGAAGAAG
TATATGAACTCTCTCCTGATTGGAGAACTGTCTCCAGAGCAGCCCAGCTTTGAGCCCACC
AAGAATAAAGAGCTGACAGATGAGTTCCGGGAGCTGCGGGCCACAGTGGAGCGGATGGGG
CTCATGAAGGCCAACCATGTCTTCTTCCTGCTGTACCTGCTGCACATCTTGCTGCTGGAT
GGTGCAGCCTGGCTCACCCTTTGGGTCTTTGGGACGTCCTTTTTGCCCTTCCTCCTCTGT
GCGGTGCTGCTCAGTGCAGTTCAGGCCCAGGCTGGCTGGCTGCAGCATGACTTTGGGCAC
CTGTCGGTCTTCAGCACCTCAAAGTGGAACCATCTGCTACATCATTTTGTGATTGGCCAC
CTGAAGGGGGCCCCCGCCAGTTGGTGGAACCACATGCACTTCCAGCACCATGCCAAGCCC
AACTGCTTCCGCAAAGACCCAGACATCAACATGCATCCCTTCTTCTTTGCCTTGGGGAAG
ATCCTCTCTGTGGAGCTTGGGAAACAGAAGAAAAAATATATGCCGTACAACCACCAGCAC
AAATACTTCTTCCTAATTGGGCCCCCAGCCTTGCTGCCTCTCTACTTCCAGTGGTATATT
TTCTATTTTGTTATCCAGCGAAAGAAGTGGGTGGACTTGGCCTGGATGATTACCTTCTAC
GTCCGCTTCTTCCTCACTTATGTGCCACTATTGGGGCTGAAAGCCTTCCTGGGCCTTTTC
TTCATAGTCAGGTTCCTGGAAAGCAACTGGTTTGTGTGGGTGACACAGATGAACCATATT
CCCATGCACATTGATCATGACCGGAACATGGACTGGGTTTCCACCCAGCTCCAGGCCACA
TGCAATGTCCACAAGTCTGCCTTCAATGACTGGTTCAGTGGACACCTCAACTTCCAGATT
GAGCACCATCTTTTTCCCACGATGCCTCGACACAATTACCACAAAGTGGCTCCCCTGGTG
CAGTCCTTGTGTGCCAAGCATGGCATAGAGTACCAGTCCAAGCCCCTGCTGTCAGCCTTC
GCCGACATCATCCACTCACTAAAGGAGTCAGGGCAGCTCTGGCTAGATGCCTATCTTCAC
CAATAA
Chromosome Location
11
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO60427
UniProtKB Entry NameFADS1_HUMAN
GenBank Protein ID3169158
GenBank Gene IDAC004770
GenAtlas IDDKFZp762M2311
HGNC IDHGNC:3574
General References
  1. Cho HP, Nakamura M, Clarke SD: Cloning, expression, and fatty acid regulation of the human delta-5 desaturase. J Biol Chem. 1999 Dec 24;274(52):37335-9. [PubMed:10601301]
  2. Leonard AE, Kelder B, Bobik EG, Chuang LT, Parker-Barnes JM, Thurmond JM, Kroeger PE, Kopchick JJ, Huang YS, Mukerji P: cDNA cloning and characterization of human Delta5-desaturase involved in the biosynthesis of arachidonic acid. Biochem J. 2000 May 1;347 Pt 3:719-24. [PubMed:10769175]
  3. Marquardt A, Stohr H, White K, Weber BH: cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family. Genomics. 2000 Jun 1;66(2):175-83. [PubMed:10860662]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  6. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  8. Park WJ, Kothapalli KS, Reardon HT, Lawrence P, Qian SB, Brenna JT: A novel FADS1 isoform potentiates FADS2-mediated production of eicosanoid precursor fatty acids. J Lipid Res. 2012 Aug;53(8):1502-12. doi: 10.1194/jlr.M025312. Epub 2012 May 22. [PubMed:22619218]
  9. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00132alpha-Linolenic acidapproved, investigational, nutraceuticalyesligandDetails
DB00159Icosapentapproved, nutraceuticalunknownagonistDetails
DB13168Omega-6 fatty acidsnutraceuticalunknownsubstrateDetails
DB09328Vayarinapproved, investigationalunknownsubstrateDetails
DB11358Evening primrose oilinvestigational, nutraceuticalnoligandDetails