Cytochrome P450 2B1
Details
- Name
- Cytochrome P450 2B1
- Synonyms
- 1.14.14.1
- Cyp2b-1
- CYPIIB1
- Cytochrome P450-B
- Cytochrome P450-LM2
- Cytochrome P450-PB1
- Cytochrome P450-PB2
- Cytochrome P450b
- Gene Name
- Cyp2b1
- Organism
- Rat
- Amino acid sequence
>lcl|BSEQ0017527|Cytochrome P450 2B1 MEPTILLLLALLVGFLLLLVRGHPKSRGNFPPGPRPLPLLGNLLQLDRGGLLNSFMQLRE KYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGRGTIAVIEPIFKEYGVIFANGER WKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIIC SIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSSQVFEFFSGFLKYFPGAHRQISKNLQE ILDYIGHIVEKHRATLDPSAPRDFIDTYLLRMEKEKSNHHTEFHHENLMISLLSLFFAGT ETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRSKMPYTDAVIHEIQRFS DLVPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDSFNPEHFLDANGAL KKSEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSVSSHLAPKDIDLTPKESGIGKI PPTYQICFSAR
- Number of residues
- 491
- Molecular Weight
- 55933.06
- Theoretical pI
- Not Available
- GO Classification
- Functionsarachidonic acid epoxygenase activity / aromatase activity / heme binding / iron ion binding / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / oxygen binding / steroid hydroxylase activityProcessesdrug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / oxidation-reduction process / response to calcium ion / response to drug / response to insulin / response to metal ion / response to organic cyclic compound / response to sulfur dioxide / xenobiotic metabolic processComponentscytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
- General Function
- Steroid hydroxylase activity
- Specific Function
- Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
- Pfam Domain Function
- p450 (PF00067)
- Transmembrane Regions
- Not Available
- Cellular Location
- Endoplasmic reticulum membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00176 UniProtKB Entry Name CP2B1_RAT - General References
- Mizukami Y, Sogawa K, Suwa Y, Muramatsu M, Fujii-Kuriyama Y: Gene structure of a phenobarbital-inducible cytochrome P-450 in rat liver. Proc Natl Acad Sci U S A. 1983 Jul;80(13):3958-62. [Article]
- Suwa Y, Mizukami Y, Sogawa K, Fujii-Kuriyama Y: Gene structure of a major form of phenobarbital-inducible cytochrome P-450 in rat liver. J Biol Chem. 1985 Jul 5;260(13):7980-4. [Article]
- Fujii-Kuriyama Y, Mizukami Y, Kawajiri K, Sogawa K, Muramatsu M: Primary structure of a cytochrome P-450: coding nucleotide sequence of phenobarbital-inducible cytochrome P-450 cDNA from rat liver. Proc Natl Acad Sci U S A. 1982 May;79(9):2793-7. [Article]
- Oesch F, Waxman DJ, Morrissey JJ, Honscha W, Kissel W, Friedberg T: Antibodies targeted against hypervariable and constant regions of cytochromes P450IIB1 and P450IIB2. Arch Biochem Biophys. 1989 Apr;270(1):23-32. [Article]
- Botelho LH, Ryan DE, Levin W: Amino acid compositions and partial amino acid sequences of three highly purified forms of liver microsomal cytochrome P-450 from rats treated with polychlorinated biphenyls, phenobarbital, or 3-methylcholanthrene. J Biol Chem. 1979 Jul 10;254(13):5635-40. [Article]
- Roberts ES, Hopkins NE, Zaluzec EJ, Gage DA, Alworth WL, Hollenberg PF: Identification of active-site peptides from 3H-labeled 2-ethynylnaphthalene-inactivated P450 2B1 and 2B4 using amino acid sequencing and mass spectrometry. Biochemistry. 1994 Mar 29;33(12):3766-71. [Article]
- Pyerin W, Taniguchi H: Phosphorylation of hepatic phenobarbital-inducible cytochrome P-450. EMBO J. 1989 Oct;8(10):3003-10. [Article]