T-cell receptor alpha chain C region
Details
- Name
- T-cell receptor alpha chain C region
- Synonyms
- TCRA
- Gene Name
- TRAC
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0007248|T-cell receptor alpha chain C region PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKS NSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIG FRILLLKVAGFNLLMTLRLWSS
- Number of residues
- 142
- Molecular Weight
- 15927.645
- Theoretical pI
- 4.38
- GO Classification
- Processesregulation of immune response / T cell costimulation / T cell receptor signaling pathwayComponentsintegral component of membrane / plasma membrane
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- DUF1968 (PF09291)
- Transmembrane Regions
- 118-137
- Cellular Location
- Membrane
- Chromosome Location
- Not Available
- Locus
- 14q11
- External Identifiers
Resource Link UniProtKB ID P01848 UniProtKB Entry Name TCA_HUMAN HGNC ID HGNC:12029 - General References
- Rabbitts TH, Lefranc MP, Stinson MA, Sims JE, Schroder J, Steinmetz M, Spurr NL, Solomon E, Goodfellow PN: The chromosomal location of T-cell receptor genes and a T cell rearranging gene: possible correlation with specific translocations in human T cell leukaemia. EMBO J. 1985 Jun;4(6):1461-5. [Article]
- Yanagi Y, Chan A, Chin B, Minden M, Mak TW: Analysis of cDNA clones specific for human T cells and the alpha and beta chains of the T-cell receptor heterodimer from a human T-cell line. Proc Natl Acad Sci U S A. 1985 May;82(10):3430-4. [Article]
- Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [Article]
- Morgan NV, Goddard S, Cardno TS, McDonald D, Rahman F, Barge D, Ciupek A, Straatman-Iwanowska A, Pasha S, Guckian M, Anderson G, Huissoon A, Cant A, Tate WP, Hambleton S, Maher ER: Mutation in the TCRalpha subunit constant gene (TRAC) leads to a human immunodeficiency disorder characterized by a lack of TCRalphabeta+ T cells. J Clin Invest. 2011 Feb;121(2):695-702. doi: 10.1172/JCI41931. Epub 2011 Jan 4. [Article]
- Kjer-Nielsen L, Clements CS, Brooks AG, Purcell AW, McCluskey J, Rossjohn J: The 1.5 A crystal structure of a highly selected antiviral T cell receptor provides evidence for a structural basis of immunodominance. Structure. 2002 Nov;10(11):1521-32. [Article]
- Stewart-Jones GB, McMichael AJ, Bell JI, Stuart DI, Jones EY: A structural basis for immunodominant human T cell receptor recognition. Nat Immunol. 2003 Jul;4(7):657-63. Epub 2003 Jun 8. [Article]
- Li Y, Huang Y, Lue J, Quandt JA, Martin R, Mariuzza RA: Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule. EMBO J. 2005 Sep 7;24(17):2968-79. Epub 2005 Aug 4. [Article]