Prostate-specific antigen

Details

Name
Prostate-specific antigen
Synonyms
  • 3.4.21.77
  • APS
  • Gamma-seminoprotein
  • Kallikrein-3
  • P-30 antigen
  • PSA
  • Semenogelase
  • Seminin
Gene Name
KLK3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049681|Prostate-specific antigen
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
Number of residues
261
Molecular Weight
28741.1
Theoretical pI
Not Available
GO Classification
Functions
endopeptidase activity / hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides / serine-type endopeptidase activity / serine-type peptidase activity
Processes
antibacterial peptide production / cellular protein metabolic process / negative regulation of angiogenesis / proteolysis
Components
extracellular exosome / extracellular region / extracellular space / nucleus / protein complex
General Function
Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
Specific Function
Endopeptidase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049682|Prostate-specific antigen (KLK3)
ATGTGGGTCCCGGTTGTCTTCCTCACCCTGTCCGTGACGTGGATTGGTGCTGCACCCCTC
ATCCTGTCTCGGATTGTGGGAGGCTGGGAGTGCGAGAAGCATTCCCAACCCTGGCAGGTG
CTTGTGGCCTCTCGTGGCAGGGCAGTCTGCGGCGGTGTTCTGGTGCACCCCCAGTGGGTC
CTCACAGCTGCCCACTGCATCAGGAACAAAAGCGTGATCTTGCTGGGTCGGCACAGCCTG
TTTCATCCTGAAGACACAGGCCAGGTATTTCAGGTCAGCCACAGCTTCCCACACCCGCTC
TACGATATGAGCCTCCTGAAGAATCGATTCCTCAGGCCAGGTGATGACTCCAGCCACGAC
CTCATGCTGCTCCGCCTGTCAGAGCCTGCCGAGCTCACGGATGCTGTGAAGGTCATGGAC
CTGCCCACCCAGGAGCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGGCAGCATT
GAACCAGAGGAGTTCTTGACCCCAAAGAAACTTCAGTGTGTGGACCTCCATGTTATTTCC
AATGACGTGTGTGCGCAAGTTCACCCTCAGAAGGTGACCAAGTTCATGCTGTGTGCTGGA
CGCTGGACAGGGGGCAAAAGCACCTGCTCGGGTGATTCTGGGGGCCCACTTGTCTGTAAT
GGTGTGCTTCAAGGTATCACGTCATGGGGCAGTGAACCATGTGCCCTGCCCGAAAGGCCT
TCCCTGTACACCAAGGTGGTGCATTACCGGAAGTGGATCAAGGACACCATCGTGGCCAAC
CCCTGA
Chromosome Location
19
Locus
19q13.33
External Identifiers
ResourceLink
UniProtKB IDP07288
UniProtKB Entry NameKLK3_HUMAN
HGNC IDHGNC:6364
General References
  1. Lundwall A, Lilja H: Molecular cloning of human prostate specific antigen cDNA. FEBS Lett. 1987 Apr 20;214(2):317-22. [Article]
  2. Digby M, Zhang XY, Richards RI: Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1. Nucleic Acids Res. 1989 Mar 11;17(5):2137. [Article]
  3. Klobeck HG, Combriato G, Schulz P, Arbusow V, Fittler F: Genomic sequence of human prostate specific antigen (PSA). Nucleic Acids Res. 1989 May 25;17(10):3981. [Article]
  4. Lundwall A: Characterization of the gene for prostate-specific antigen, a human glandular kallikrein. Biochem Biophys Res Commun. 1989 Jun 30;161(3):1151-9. [Article]
  5. Henttu P, Vihko P: cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes. Biochem Biophys Res Commun. 1989 Apr 28;160(2):903-10. [Article]
  6. Riegman PH, Vlietstra RJ, van der Korput JA, Romijn JC, Trapman J: Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene. Biochem Biophys Res Commun. 1989 Feb 28;159(1):95-102. [Article]
  7. Baffa R, Moreno JG, Monne M, Veronese ML, Gomella LG: A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue. Urology. 1996 Jun;47(6):795-800. [Article]
  8. Gan L, Lee I, Smith R, Argonza-Barrett R, Lei H, McCuaig J, Moss P, Paeper B, Wang K: Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region. Gene. 2000 Oct 17;257(1):119-30. [Article]
  9. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [Article]
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  11. Monne M, Croce CM, Yu H, Diamandis EP: Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors. Cancer Res. 1994 Dec 15;54(24):6344-7. [Article]
  12. Schulz P, Stucka R, Feldmann H, Combriato G, Klobeck HG, Fittler F: Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence. Nucleic Acids Res. 1988 Jul 11;16(13):6226. [Article]
  13. Watt KW, Lee PJ, M'Timkulu T, Chan WP, Loor R: Human prostate-specific antigen: structural and functional similarity with serine proteases. Proc Natl Acad Sci U S A. 1986 May;83(10):3166-70. [Article]
  14. Schaller J, Akiyama K, Tsuda R, Hara M, Marti T, Rickli EE: Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma. Eur J Biochem. 1987 Dec 30;170(1-2):111-20. [Article]
  15. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [Article]
  16. Vegvari A, Sjodin K, Rezeli M, Malm J, Lilja H, Laurell T, Marko-Varga G: Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring. Mol Cell Proteomics. 2013 Oct;12(10):2761-73. doi: 10.1074/mcp.M113.028365. Epub 2013 Jul 10. [Article]
  17. Espana F, Gilabert J, Estelles A, Romeu A, Aznar J, Cabo A: Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen. Thromb Res. 1991 Nov 1;64(3):309-20. [Article]
  18. Villoutreix BO, Getzoff ED, Griffin JH: A structural model for the prostate disease marker, human prostate-specific antigen. Protein Sci. 1994 Nov;3(11):2033-44. [Article]
  19. Coombs GS, Bergstrom RC, Pellequer JL, Baker SI, Navre M, Smith MM, Tainer JA, Madison EL, Corey DR: Substrate specificity of prostate-specific antigen (PSA). Chem Biol. 1998 Sep;5(9):475-88. [Article]
  20. Menez R, Michel S, Muller BH, Bossus M, Ducancel F, Jolivet-Reynaud C, Stura EA: Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody. J Mol Biol. 2008 Feb 29;376(4):1021-33. doi: 10.1016/j.jmb.2007.11.052. Epub 2007 Nov 22. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04839Cyproterone acetateapproved, investigationalunknownDetails
DB00834Mifepristoneapproved, investigationalunknownDetails
DB16019Gallium Ga-68 gozetotideapprovedyesbinderDetails
DB16778Lutetium Lu-177 vipivotide tetraxetanapprovedyesbinderDetails
DB02998MetriboloneexperimentalunknownactivatorDetails