Phosphocarrier protein HPr

Details

Name
Phosphocarrier protein HPr
Synonyms
  • 2.7.11.-
  • Histidine-containing protein
Gene Name
ptsH
Organism
Enterococcus faecalis (strain ATCC 700802 / V583)
Amino acid sequence
>lcl|BSEQ0017058|Phosphocarrier protein HPr
MEKKEFHIVAETGIHARPATLLVQTASKFNSDINLEYKGKSVNLKSIMGVMSLGVGQGSD
VTITVDGADEAEGMAAIVETLQKEGLAE
Number of residues
88
Molecular Weight
9320.575
Theoretical pI
4.58
GO Classification
Functions
protein serine/threonine kinase activity
Processes
phosphoenolpyruvate-dependent sugar phosphotransferase system / regulation of transcription, DNA-templated / transcription, DNA-templated
Components
cytoplasm
General Function
Protein serine/threonine kinase activity
Specific Function
General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the permease (enzymes II/III).P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0017059|Phosphocarrier protein HPr (ptsH)
ATGGAAAAGAAAGAATTTCACATTGTAGCAGAAACAGGAATTCACGCACGTCCAGCTACT
TTATTAGTACAAACTGCAAGCAAATTTAACTCAGATATTAACTTAGAATACAAAGGTAAA
TCTGTTAACTTAAAATCAATCATGGGCGTTATGTCTTTAGGCGTTGGTCAAGGTTCTGAC
GTAACAATCACTGTTGATGGTGCTGACGAAGCTGAAGGAATGGCAGCAATCGTTGAAACA
TTACAAAAAGAAGGATTGGCTGAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP07515
UniProtKB Entry NamePTHP_ENTFA
GenBank Gene IDZ19137
General References
  1. Deutscher J, Pevec B, Beyreuther K, Kiltz HH, Hengstenberg W: Streptococcal phosphoenolpyruvate-sugar phosphotransferase system: amino acid sequence and site of ATP-dependent phosphorylation of HPr. Biochemistry. 1986 Oct 21;25(21):6543-51. [Article]
  2. Paulsen IT, Banerjei L, Myers GS, Nelson KE, Seshadri R, Read TD, Fouts DE, Eisen JA, Gill SR, Heidelberg JF, Tettelin H, Dodson RJ, Umayam L, Brinkac L, Beanan M, Daugherty S, DeBoy RT, Durkin S, Kolonay J, Madupu R, Nelson W, Vamathevan J, Tran B, Upton J, Hansen T, Shetty J, Khouri H, Utterback T, Radune D, Ketchum KA, Dougherty BA, Fraser CM: Role of mobile DNA in the evolution of vancomycin-resistant Enterococcus faecalis. Science. 2003 Mar 28;299(5615):2071-4. [Article]
  3. Jia Z, Vandonselaar M, Quail JW, Delbaere LT: Active-centre torsion-angle strain revealed in 1.6 A-resolution structure of histidine-containing phosphocarrier protein. Nature. 1993 Jan 7;361(6407):94-7. [Article]
  4. Audette GF, Engelmann R, Hengstenberg W, Deutscher J, Hayakawa K, Quail JW, Delbaere LT: The 1.9 A resolution structure of phospho-serine 46 HPr from Enterococcus faecalis. J Mol Biol. 2000 Nov 3;303(4):545-53. [Article]
  5. Hahmann M, Maurer T, Lorenz M, Hengstenberg W, Glaser S, Kalbitzer HR: Structural studies of histidine-containing phosphocarrier protein from Enterococcus faecalis. Eur J Biochem. 1998 Feb 15;252(1):51-8. [Article]
  6. Maurer T, Doker R, Gorler A, Hengstenberg W, Kalbitzer HR: Three-dimensional structure of the histidine-containing phosphocarrier protein (HPr) from Enterococcus faecalis in solution. Eur J Biochem. 2001 Feb;268(3):635-44. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04522DexfosfoserineexperimentalunknownDetails