DNA polymerase catalytic subunit

Details

Name
DNA polymerase catalytic subunit
Synonyms
  • 2.7.7.7
  • HFLF2
Gene Name
UL54
Organism
HHV-5
Amino acid sequence
>lcl|BSEQ0010099|DNA polymerase catalytic subunit
MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQIVPRGVMFDGQTGLIKH
KTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIRFHTYDQTDAVLFFDSPENVS
PRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCEYSDTDRLREVIASVGELVPE
PRTPYAVSVTPATKTSIYGYGTRPVPDLQCVSISNWTMARKIGEYLLEQGFPVYEVRVDP
LTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEVDCDVSDLVAVPDDSSWPRYRCLSF
DIECMSGEGGFPCAEKSDDIVIQISCVCYETGGNTAVDQGIPNGNDGRGCTSEGVIFGHS
GLHLFTIGTCGQVGPDVDVYEFPSEYELLLGFMLFFQRYAPAFVTGYNINSFDLKYILTR
LEYLYKVDSQRFCKLPTAQGGRFFLHSPAVGFKRQYAAAFPSASHNNPASTAATKVYIAG
SVVIDMYPVCMAKTNSPNYKLNTMAELYLRQRKDDLSYKDIPRCFVANAEGRAQVGRYCL
QDAVLVRDLFNTINFHYEAGAIARLAKIPLRRVIFDGQQIRIYTSLLDECACRDFILPNH
YSKGTTVPETNSVAVSPNAAIISTAAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGS
NSSSSVGVFSVGSGSSGGVGVSNDNHGAGGTAAVSYQGATVFEPEVGYYNDPVAVFDFAS
LYPSIIMAHNLCYSTLLVPGGEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKW
VSQRRAVRECMRECQDPVRRMLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRI
GRDMLERTARFIKDNFSEPCFLHNFFNQEDYVVGTREGDSEESSALPEGLETSSGGSNER
RVEARVIYGDTDSVFVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMI
CKKRYIGKVEGASGLSMKGVDLVRKTACEFVKGVTRDVLSLLFEDREVSEAAVRLSRLSL
DEVKKYGVPRGFWRILRRLVQARDDLYLHRVRVEDLVLSSVLSKDISLYRQSNLPHIAVI
KRLAARSEELPSVGDRVFYVLTAPGVRTAPQGSSDNGDSVTAGVVSRSDAIDGTDDDADG
GGVEESNRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNV
LSPVFPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC
Number of residues
1242
Molecular Weight
137100.705
Theoretical pI
7.33
GO Classification
Functions
3'-5' exonuclease activity / DNA binding / DNA-directed DNA polymerase activity / nucleotide binding
Processes
bidirectional double-stranded viral DNA replication
Components
host cell nucleus
General Function
Nucleotide binding
Specific Function
Replicates viral genomic DNA in the late phase of lytic infection, producing long concatemeric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Host nucleus
Gene sequence
>lcl|BSEQ0000682|3729 bp
TCAACAGCATTCGTGCGCCTTGACACTGTACGGCAGAAAAGCCGGCTCCAAGTGCAAGCG
CCGCGGCAGCACCATGTGCAAAAACTTGTCCTTGCGCGCGGTTTCGCCGCCGGGAAAGAC
GGGCGACAGCACGTTAGTTACAGCCTTGAGAACCTGCTCAAAGTACTTGTCGGCGTGAAT
GGGCACGCCGTGCTCGCGCACGTAGCTCGGATCTTCGGCTACCTCGTAGTTGCACACGGC
CGACGGTGGTTTCCGCGCCCTCTTCTTTGCCGGCTCTCCTCCTCTCCTGTTGCTCTCCTC
TACCCCGCCGCCGTCAGCGTCGTCGTCCGTGCCATCAATCGCGTCCGACCGGGAAACCAC
GCCGGCGGTTACAGAATCACCGTTGTCGGAGGAACCCTGCGGCGCCGTCCGGACACCGGG
CGCCGTCAGAACGTAAAAGACCCGATCCCCGACCGAGGGTAGCTCCTCAGAACGGGCCGC
CAATCGCTTAATGACGGCAATGTGCGGCAGGTTAGATTGACGGTACAGCGAGATGTCCTT
AGAGAGCACCGACGAAAGCACCAGGTCCTCGACACGCACACGGTGCAGGTACAGATCGTC
GCGGGCCTGCACCAAGCGGCGTAAGATACGCCAGAAACCGCGTGGCACGCCGTACTTCTT
GACTTCATCGAGTGAGAGGCGCGACAGGCGCACGGCTGCTTCCGAGACCTCGCGATCCTC
AAAGAGCAGCGAGAGGACGTCACGCGTGACGCCCTTGACGAACTCGCAGGCCGTCTTGCG
CACCAGATCCACGCCCTTCATGCTCAGACCCGAGGCGCCCTCCACTTTGCCGATGTAACG
TTTCTTGCAGATCATCATAAGAGAGACGAAGACCTTTTCAAACTCCAGCTTGACGGGCTC
CACAAAAAGACAGGCCGTCACGTAGTGCGCCAGGCTGGGCCCACGCGCCACCAGAGCCTG
CGGCGTCAGGCCACGAAAGCGGACAAACACGCTGTCCGTGTCCCCGTAGATGACCCGCGC
CTCCACCCGCCGTTCGTTCGAGCCCCCTGACGATGTTTCGAGCCCCTCCGGTAACGCGCT
GCTCTCCTCCGAATCCCCCTCCCGCGTTCCCACTACATAGTCTTCCTGATTAAAAAAATT
GTGCAAAAAACACGGCTCTGAAAAGTTGTCTTTGATGAACCGCGCCGTGCGCTCTAGCAT
GTCGCGACCGATGCGCGTGATGCTGGCGGCGATGGGCAGACACGGCATCATACCGTTGAC
CACGCCGGTAAAACCGTAGAAAGCGTTGCACGTTACTTTGAGCGCCATCTGTTCCTTGTC
GAGCAGCATACGGCGCACAGGGTCTTGACACTCGCGCATGCATTCGCGCACGGCACGCCG
CTGCGAAACCCACTTGTTGAGCAGTTCCGAGAGCACCGAGACGCGCACCGAAGCACGCAC
AAAGCGGTGGGTCACGCCGTTCTCTAGCGTGACGCTGTATACGTCGGCGGGGTCCACAGG
GTACTCGCCACCCGGCACCAGCAGGGTGGAGTAGCAGAGGTTGTGGGCCATGATGATGGA
AGGGTAGAGGCTGGCAAAGTCGAACACGGCCACGGGGTCGTTGTAGTAACCCACCTCGGG
CTCAAACACCGTGGCGCCCTGGTACGAAACCGCCGCAGTACCGCCGGCGCCGTGATTGTC
GTTGGAAACGCCGACGCCGCCACTACTGCCGGAGCCGACGCTGAAAACGCCGACGCTGCT
ACTACTGTTACTGCCGGAGCCGGGTGAAACGCCGTCCTGACTGGACGGCGCAGATTGCAA
GGGCGGCGACATCTGAAACATAGCCGCCACAGAACCCGCGTCGCCGGGCACAGCGGCGGT
AGAGATGATAGCAGCGTTAGGTGACACAGCAACGCTATTCGTTTCGGGCACCGTCGTACC
TTTGCTGTAGTGGTTGGGCAGGATAAAATCGCGGCAGGCGCACTCGTCCAGCAGCGAGGT
GTAGATACGGATCTGCTGTCCGTCAAAGATGACACGCCGCAACGGAATTTTAGCCAGCCG
CGCGATGGCCCCGGCCTCGTAGTGAAAATTAATGGTGTTGAACAGATCGCGCACCAATAC
GGCGTCCTGCAGACAGTAACGGCCTACCTGGGCGCGGCCCTCGGCATTAGCCACGAAACA
ACGCGGGATGTCCTTGTAAGACAGGTCATCCTTGCGTTGCCGCAGGTAAAGCTCGGCCAT
AGTGTTGAGCTTATAGTTGGGCGAGTTAGTCTTGGCCATGCATACAGGGTACATGTCGAT
AACCACCGAACCCGCAATATACACCTTGGTGGCGGCCGTGCTGGCCGGATTGTTGTGAGA
AGCCGAGGGAAAAGCGGCGGCGTACTGCCGCTTAAAACCCACGGCGGGGCTGTGTAAAAA
GAAACGGCCGCCCTGCGCCGTAGGCAACTTGCAGAAGCGCTGCGAGTCCACCTTATACAG
GTACTCGAGACGCGTGAGGATGTACTTCAAGTCAAAAGAGTTGATGTTGTAACCGGTCAC
AAAGGCCGGCGCGTACCGTTGAAAGAAAAGCATAAAGCCCAGCAGCAGCTCGTATTCGGA
AGGGAACTCGTAGACGTCCACGTCTGGGCCCACCTGCCCGCAGGTGCCGATCGTAAAGAG
ATGAAGACCCGAGTGCCCAAAGATCACACCCTCCGAAGTGCAGCCCCGACCATCGTTCCC
GTTTGGGATCCCCTGATCCACGGCGGTGTTTCCCCCCGTCTCGTAGCACACGCACGAGAT
CTGAATGACAATGTCATCGGACTTCTCGGCGCAGGGAAAACCACCCTCGCCGCTCATGCA
CTCGATATCGAAGGACAGGCATCGATAGCGCGGCCACGAGCTGTCGTCGGGCACAGCCAC
CAGGTCAGAGACATCGCAGTCTACCTCGATATCACAAGTCGACGCGCGACCCTGCTGCCG
CCAGTCGTAACGATTCACGGAGCACCAGCCGAACGTGGTGATCCGCCGATCGATGACCAA
ACGCGTCAGCGGATCCACACGGACCTCGTACACGGGAAAACCCTGCTCCAGCAGATACTC
GCCGATTTTTCTGGCCATGGTCCAGTTGCTGATAGACACACACTGCAAATCGGGCACGGG
TCGCGTCCCGTACCCATAGATGGAGGTCTTGGTGGCCGGCGTGACAGACACGGCGTATGG
CGTCCGCGGTTCGGGCACTAGTTCGCCCACGCTGGCAATGACCTCACGCAGCCTATCGGT
GTCGCTGTACTCACAGTAAAAGTAGCTGCGCTGCCCGAAAACGTTGACGCAGATACTGTA
GCCGTGTTCTGTGGCCCCGAAGAAACGCAACACGTTCCCCGAAGGCACCAGATGCTGACG
ATAGCGCGGCGACACGTTTTCGGGCGAGTCGAAGAAGAGCACGGCGTCCGTCTGATCGTA
GGTGTGAAAACGAATAGGTCCCACCACGCGACCCACCAGGGTCTCGCGCCAAGGACACGG
CCAAACCATGTCATGACTCAACAAATGTTTAATCTCTCGATAGAACATGAGAGGCAGCCG
TCCCGTCTTATGCTTGATCAACCCCGTCTGACCGTCGAACATGACACCTCGCGGCACGAT
CTGCAAAAACTGTTTCTGTGGCGGCCGCTTGCCCGAGCCCTGCGCGGAGCCGGGCTGCGA
ACGCTGACGCCGGCCACCCGCGACCGCACCGCCGGTCACGCCGCCGCTCAGATACGGGTT
GAAAAACAT
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP08546
UniProtKB Entry NameDPOL_HCMVA
GenBank Protein ID1780831
GenBank Gene IDX17403
General References
  1. Kouzarides T, Bankier AT, Satchwell SC, Weston K, Tomlinson P, Barrell BG: Sequence and transcription analysis of the human cytomegalovirus DNA polymerase gene. J Virol. 1987 Jan;61(1):125-33. [PubMed:3023690]
  2. Kouzarides T, Bankier AT, Satchwell SC, Weston K, Tomlinson P, Barrell BG: Large-scale rearrangement of homologous regions in the genomes of HCMV and EBV. Virology. 1987 Apr;157(2):397-413. [PubMed:3029980]
  3. Chee MS, Bankier AT, Beck S, Bohni R, Brown CM, Cerny R, Horsnell T, Hutchison CA 3rd, Kouzarides T, Martignetti JA, et al.: Analysis of the protein-coding content of the sequence of human cytomegalovirus strain AD169. Curr Top Microbiol Immunol. 1990;154:125-69. [PubMed:2161319]
  4. Davison AJ, Dolan A, Akter P, Addison C, Dargan DJ, Alcendor DJ, McGeoch DJ, Hayward GS: The human cytomegalovirus genome revisited: comparison with the chimpanzee cytomegalovirus genome. J Gen Virol. 2003 Jan;84(Pt 1):17-28. [PubMed:12533697]
  5. Varnum SM, Streblow DN, Monroe ME, Smith P, Auberry KJ, Pasa-Tolic L, Wang D, Camp DG 2nd, Rodland K, Wiley S, Britt W, Shenk T, Smith RD, Nelson JA: Identification of proteins in human cytomegalovirus (HCMV) particles: the HCMV proteome. J Virol. 2004 Oct;78(20):10960-6. [PubMed:15452216]
  6. Appleton BA, Brooks J, Loregian A, Filman DJ, Coen DM, Hogle JM: Crystal structure of the cytomegalovirus DNA polymerase subunit UL44 in complex with the C terminus from the catalytic subunit. Differences in structure and function relative to unliganded UL44. J Biol Chem. 2006 Feb 24;281(8):5224-32. Epub 2005 Dec 20. [PubMed:16371349]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00369CidofovirapprovedyesinhibitorDetails
DB00529FoscarnetapprovedyesinhibitorDetails