Ribosome-recycling factor
Details
- Name
- Ribosome-recycling factor
- Synonyms
- Ribosome-releasing factor
- rrf
- Gene Name
- frr
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0012806|Ribosome-recycling factor MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE DSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGE AEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEA ELMQF
- Number of residues
- 185
- Molecular Weight
- 20638.31
- Theoretical pI
- 6.88
- GO Classification
- Functionsribosomal large subunit bindingProcessescytoplasmic translational terminationComponentscytoplasm / cytosol
- General Function
- Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.
- Specific Function
- Ribosomal large subunit binding
- Pfam Domain Function
- RRF (PF01765)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0012807|Ribosome-recycling factor (frr) GTGATTAGCGATATCAGAAAAGATGCTGAAGTACGCATGGACAAATGCGTAGAAGCGTTC AAAACCCAAATCAGCAAAATACGCACGGGTCGTGCTTCTCCCAGCCTGCTGGATGGCATT GTCGTGGAATATTACGGCACGCCGACGCCGCTGCGTCAGCTGGCAAGCGTAACGGTAGAA GATTCCCGTACACTGAAAATCAACGTGTTTGATCGTTCAATGTCTCCGGCCGTTGAAAAA GCGATTATGGCGTCCGATCTTGGCCTGAACCCGAACTCTGCGGGTAGCGACATCCGTGTT CCGCTGCCGCCGCTGACGGAAGAACGTCGTAAAGATCTGACCAAAATCGTTCGTGGTGAA GCAGAACAAGCGCGTGTTGCAGTACGTAACGTGCGTCGTGACGCGAACGACAAAGTGAAA GCACTGTTGAAAGATAAAGAGATCAGCGAAGACGACGATCGCCGTTCTCAGGACGATGTA CAGAAACTGACTGATGCTGCAATCAAGAAAATTGAAGCGGCGCTGGCAGACAAAGAAGCA GAACTGATGCAGTTCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A805 UniProtKB Entry Name RRF_ECOLI GenBank Protein ID 147771 GenBank Gene ID J05113 - General References
- Ichikawa S, Kaji A: Molecular cloning and expression of ribosome releasing factor. J Biol Chem. 1989 Nov 25;264(33):20054-9. [Article]
- Yamanaka K, Ogura T, Niki H, Hiraga S: Identification and characterization of the smbA gene, a suppressor of the mukB null mutant of Escherichia coli. J Bacteriol. 1992 Dec;174(23):7517-26. [Article]
- Fujita N, Mori H, Yura T, Ishihama A: Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region. Nucleic Acids Res. 1994 May 11;22(9):1637-9. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. [Article]
- Shimizu I, Kaji A: Identification of the promoter region of the ribosome-releasing factor cistron (frr). J Bacteriol. 1991 Aug;173(16):5181-7. [Article]
- Janosi L, Shimizu I, Kaji A: Ribosome recycling factor (ribosome releasing factor) is essential for bacterial growth. Proc Natl Acad Sci U S A. 1994 May 10;91(10):4249-53. [Article]
- Zhang J, Sprung R, Pei J, Tan X, Kim S, Zhu H, Liu CF, Grishin NV, Zhao Y: Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli. Mol Cell Proteomics. 2009 Feb;8(2):215-25. doi: 10.1074/mcp.M800187-MCP200. Epub 2008 Aug 23. [Article]
- Agrawal RK, Sharma MR, Kiel MC, Hirokawa G, Booth TM, Spahn CM, Grassucci RA, Kaji A, Frank J: Visualization of ribosome-recycling factor on the Escherichia coli 70S ribosome: functional implications. Proc Natl Acad Sci U S A. 2004 Jun 15;101(24):8900-5. Epub 2004 Jun 3. [Article]