Hut operon positive regulatory protein
Details
- Name
- Hut operon positive regulatory protein
- Synonyms
- Not Available
- Gene Name
- hutP
- Organism
- Bacillus subtilis (strain 168)
- Amino acid sequence
>lcl|BSEQ0002548|Hut operon positive regulatory protein MTLHKERRIGRLSVLLLLNEAEESTQVEELERDGWKVCLGKVGSMDAHKVVAAIETASKK SGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVGLRFAVLRGNPYESEAEGDW IAVSLYGTIGAPIKGLEHETFGVGINHI
- Number of residues
- 148
- Molecular Weight
- 16195.415
- Theoretical pI
- 6.4
- GO Classification
- FunctionsmRNA bindingProcesseshistidine metabolic process / positive regulation of gene expression / regulation of transcription, DNA-templated / transcription, DNA-templated
- General Function
- Mrna binding
- Specific Function
- Antiterminator that binds to cis-acting regulatory sequences on the mRNA in the presence of histidine, thereby suppressing transcription termination and activating the hut operon for histidine utilization.
- Pfam Domain Function
- HutP (PF09021)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0002547|456 bp GTGATTCATATGACACTGCATAAAGAGCGTCGGATCGGCCGGCTGTCTGTTCTCCTGCTG CTGAATGAGGCGGAAGAAAGTACGCAGGTTGAGGAGCTGGAGCGAGACGGATGGAAGGTC TGTCTTGGCAAGGTAGGATCAATGGACGCACATAAAGTAGTAGCCGCAATTGAAACCGCT TCCAAAAAGAGCGGTGTCATTCAATCTGAGGGTTATCGGGAGTCACATGCGCTTTATCAT GCGACGATGGAGGCTTTGCATGGCGTGACCAGAGGTGAAATGCTGCTGGGATCGCTGCTT CGGACGGTGGGATTGAGGTTTGCCGTTTTGAGGGGAAATCCTTATGAAAGTGAAGCGGAA GGCGATTGGATCGCTGTCTCGCTTTACGGAACAATCGGGGCGCCGATTAAAGGTCTTGAG CATGAAACATTCGGCGTTGGAATTAATCACATATGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P10943 UniProtKB Entry Name HUTP_BACSU GenBank Protein ID 143075 GenBank Gene ID M20659 - General References
- Oda M, Sugishita A, Furukawa K: Cloning and nucleotide sequences of histidase and regulatory genes in the Bacillus subtilis hut operon and positive regulation of the operon. J Bacteriol. 1988 Jul;170(7):3199-205. [Article]
- Yoshida K, Sano H, Seki S, Oda M, Fujimura M, Fujita Y: Cloning and sequencing of a 29 kb region of the Bacillus subtilis genome containing the hut and wapA loci. Microbiology. 1995 Feb;141 ( Pt 2):337-43. [Article]
- Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
- Oda M, Kobayashi N, Ito A, Kurusu Y, Taira K: cis-acting regulatory sequences for antitermination in the transcript of the Bacillus subtilis hut operon and histidine-dependent binding of HutP to the transcript containing the regulatory sequences. Mol Microbiol. 2000 Mar;35(5):1244-54. [Article]
- Oda M, Kobayashi N, Fujita M, Miyazaki Y, Sadaie Y, Kurusu Y, Nishikawa S: Analysis of HutP-dependent transcription antitermination in the Bacillus subtilis hut operon: identification of HutP binding sites on hut antiterminator RNA and the involvement of the N-terminus of HutP in binding of HutP to the antiterminator RNA. Mol Microbiol. 2004 Feb;51(4):1155-68. [Article]
- Kumarevel TS, Fujimoto Z, Padmanabhan B, Oda M, Nishikawa S, Mizuno H, Kumar PK: Crystallization and preliminary X-ray diffraction studies of HutP protein: an RNA-binding protein that regulates the transcription of hut operon in Bacillus subtilis. J Struct Biol. 2002 Jun;138(3):237-40. [Article]