Cytochrome c oxidase subunit 7A1, mitochondrial
Details
- Name
- Cytochrome c oxidase subunit 7A1, mitochondrial
- Synonyms
- COX7AH
- Cytochrome c oxidase subunit VIIa-H
- Cytochrome c oxidase subunit VIIa-heart
- Cytochrome c oxidase subunit VIIa-M
- Cytochrome c oxidase subunit VIIa-muscle
- Gene Name
- COX7A1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012783|Cytochrome c oxidase subunit 7A1, mitochondrial MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLC LGGTVYSLYSLGWASFPRN
- Number of residues
- 79
- Molecular Weight
- 9117.44
- Theoretical pI
- 10.52
- GO Classification
- Functionscytochrome-c oxidase activityProcessesgeneration of precursor metabolites and energy / hydrogen ion transmembrane transportComponentsintegral component of membrane / mitochondrial respiratory chain / mitochondrion
- General Function
- Cytochrome-c oxidase activity
- Specific Function
- This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
- Pfam Domain Function
- COX7a (PF02238)
- Transmembrane Regions
- 47-75
- Cellular Location
- Mitochondrion inner membrane
- Gene sequence
>lcl|BSEQ0012784|Cytochrome c oxidase subunit 7A1, mitochondrial (COX7A1) ATGCAGGCCCTTCGGGTGTCCCAGGCGCTGATCCGCTCCTTCAGCTCCACCGCCCGGAAC CGCTTTCAGAACCGAGTGCGCGAGAAACAGAAGCTCTTCCAGGAGGACAATGACATCCCG TTGTACCTGAAGGGCGGCATCGTTGACAACATCCTGTACCGAGTGACAATGACGCTGTGT CTGGGCGGCACTGTCTACAGCTTGTACTCCCTTGGCTGGGCCTCCTTCCCCAGGAATTAA
- Chromosome Location
- 19
- Locus
- 19q13.1
- External Identifiers
Resource Link UniProtKB ID P24310 UniProtKB Entry Name CX7A1_HUMAN GenBank Protein ID 181405 GenBank Gene ID M83186 HGNC ID HGNC:2287 - General References
- Arnaudo E, Hirano M, Seelan RS, Milatovich A, Hsieh CL, Fabrizi GM, Grossman LI, Francke U, Schon EA: Tissue-specific expression and chromosome assignment of genes specifying two isoforms of subunit VIIa of human cytochrome c oxidase. Gene. 1992 Oct 1;119(2):299-305. [Article]
- Wolz W, Kress W, Mueller CR: Genomic sequence and organization of the human gene for cytochrome c oxidase subunit (COX7A1) VIIa-M. Genomics. 1997 Oct 15;45(2):438-42. [Article]
- Yu M, Jaradat SA, Grossman LI: Genomic organization and promoter regulation of human cytochrome c oxidase subunit VII heart/muscle isoform (COX7AH). Biochim Biophys Acta. 2002 Apr 12;1574(3):345-53. [Article]
- Schmidt TR, Goodman M, Grossman LI: Molecular evolution of the COX7A gene family in primates. Mol Biol Evol. 1999 May;16(5):619-26. [Article]
- Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Van Kuilenburg AB, Van Beeumen JJ, Van der Meer NM, Muijsers AO: Subunits VIIa,b,c of human cytochrome c oxidase. Identification of both 'heart-type' and 'liver-type' isoforms of subunit VIIa in human heart. Eur J Biochem. 1992 Jan 15;203(1-2):193-9. [Article]