Lanosterol 14-alpha demethylase

Details

Name
Lanosterol 14-alpha demethylase
Synonyms
  • 1.14.13.70
  • CYP51
  • CYPLI
  • Cytochrome P450 51
  • Cytochrome P450-14DM
  • Cytochrome P450-LIA1
  • Sterol 14-alpha demethylase
Gene Name
ERG11
Organism
Yeast
Amino acid sequence
>lcl|BSEQ0010481|Lanosterol 14-alpha demethylase
MSTENTSLVVELLEYVKLGLSYFQALPLAQRVSIMVALPFVYTITWQLLYSLRKDRPPLV
FYWIPWVGSAIPYGTKPYEFFEDCQKKYGDIFSFMLLGRIMTVYLGPKGHEFIFNAKLAD
VSAEAAYSHLTTPVFGKGVIYDCPNHRLMEQKKFVKGALTKEAFVRYVPLIAEEIYKYFR
NSKNFKINENNSGIVDVMVSQPEMTIFTASRSLLGKEMRDKLDTDFAYLYSDLDKGFTPI
NFVFPNLPLEHYRKRDHAQQAISGTYMSLIKERREKNDIQNRDLIDELMKNSTYKDGTKM
TDQEIANLLIGVLMGGQHTSAATSAWCLLHLAERPDVQEELYQEQMRVLNNDTKELTYDD
LQNMPLLNQMIKETLRLHHPLHSLFRKVMRDVAIPNTSYVVPRDYHVLVSPGYTHLQEEF
FPKPNEFNIHRWDGDAASSSAAGGDEVDYGFGAISKGVSSPYLPFGGGRHRCIGELFAYC
QLGVLMSIFIRTMKWRYPTEGETVPPSDFTSMVTLPTAPAKIYWEKRHPEQKY
Number of residues
533
Molecular Weight
61304.95
Theoretical pI
7.07
GO Classification
Functions
drug binding / heme binding / iron ion binding / sterol 14-demethylase activity
Processes
ergosterol biosynthetic process
Components
membrane
General Function
Sterol 14-demethylase activity
Specific Function
Catalyzes C14-demethylation of lanosterol which is critical for ergosterol biosynthesis. It transforms lanosterol into 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010482|Lanosterol 14-alpha demethylase (ERG11)
ATGTCCACTGAAAACACTTCTTTGGTCGTTGAACTATTGGAGTACGTGAAGCTTGGTCTT
TCGTACTTCCAAGCTCTGCCATTGGCGCAGAGAGTGTCTATTATGGTCGCCTTGCCATTT
GTGTACACCATCACATGGCAATTGCTTTACTCCTTGAGAAAGGACAGACCACCACTTGTG
TTCTACTGGATCCCATGGGTCGGCTCTGCTATCCCATACGGTACCAAGCCATACGAGTTC
TTCGAAGACTGCCAAAAGAAATACGGTGATATCTTCTCTTTCATGCTATTGGGTAGAATT
ATGACTGTCTACTTGGGTCCAAAGGGTCACGAATTCATCTTCAACGCCAAGTTGGCCGAT
GTTTCCGCTGAAGCTGCTTACTCCCACTTGACCACCCCAGTGTTCGGTAAAGGTGTTATC
TACGATTGTCCAAACCACAGACTAATGGAACAAAAGAAGTTTGTCAAGGGTGCTTTGACT
AAGGAAGCCTTTGTCAGATACGTTCCATTGATCGCTGAGGAAATCTACAAGTACTTCAGA
AACTCCAAGAACTTCAAGATCAACGAAAACAACTCCGGTATCGTCGACGTTATGGTCTCC
CAACCTGAAATGACTATCTTCACTGCTTCCAGATCCTTGCTAGGTAAGGAAATGAGAGAC
AAGTTGGACACCGACTTCGCTTACTTGTACAGTGACTTGGACAAGGGTTTCACCCCAATT
AACTTCGTCTTCCCTAACTTGCCTCTAGAACACTACAGAAAGAGAGATCATGCCCAACAA
GCTATCTCTGGTACTTACATGTCCTTGATTAAGGAAAGACGTGAGAAGAACGATATCCAA
AACCGTGACTTGATTGATGAATTGATGAAGAACTCCACTTACAAGGATGGTACTAAGATG
ACCGACCAAGAAATTGCCAACCTATTGATTGGTGTCTTGATGGGTGGTCAACATACTTCC
GCTGCTACCTCCGCTTGGTGTCTATTGCATTTGGCTGAAAGACCAGATGTCCAAGAAGAA
TTATACCAAGAACAAATGCGCGTCTTGAACAACGATACCAAGGAATTGACTTACGATGAC
CTACAAAACATGCCTCTATTGAACCAAATGATCAAGGAAACTTTGAGATTGCACCACCCA
TTGCACTCTTTGTTCCGTAAAGTCATGAGAGATGTCGCTATTCCAAACACTTCCTACGTT
GTCCCAAGGGACTACCACGTTCTAGTCTCCCCAGGTTACACTCACTTGCAAGAAGAATTC
TTCCCTAAGCCAAATGAATTCAACATCCACCGTTGGGACGGTGATGCTGCTTCTTCCAGT
GCTGCTGGTGGTGACGAAGTTGATTACGGTTTCGGTGCTATCTCCAAGGGTGTTTCCTCT
CCATACTTGCCATTCGGTGGTGGTAGACACAGATGTATCGGTGAATTGTTCGCTTACTGT
CAATTGGGTGTGTTGATGTCCATTTTCATCAGAACCATGAAATGGCGTTACCCAACTGAA
GGTGAAACTGTCCCACCATCTGACTTCACCTCCATGGTCACCCTACCAACTGCCCCTGCT
AAGATCTACTGGGAAAAGAGACATCCAGAACAAAAGTACTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP50859
UniProtKB Entry NameCP51_CANGA
GenBank Protein ID755693
GenBank Gene IDL40389
General References
  1. Geber A, Hitchcock CA, Swartz JE, Pullen FS, Marsden KE, Kwon-Chung KJ, Bennett JE: Deletion of the Candida glabrata ERG3 and ERG11 genes: effect on cell viability, cell growth, sterol composition, and antifungal susceptibility. Antimicrob Agents Chemother. 1995 Dec;39(12):2708-17. [Article]
  2. Dujon B, Sherman D, Fischer G, Durrens P, Casaregola S, Lafontaine I, De Montigny J, Marck C, Neuveglise C, Talla E, Goffard N, Frangeul L, Aigle M, Anthouard V, Babour A, Barbe V, Barnay S, Blanchin S, Beckerich JM, Beyne E, Bleykasten C, Boisrame A, Boyer J, Cattolico L, Confanioleri F, De Daruvar A, Despons L, Fabre E, Fairhead C, Ferry-Dumazet H, Groppi A, Hantraye F, Hennequin C, Jauniaux N, Joyet P, Kachouri R, Kerrest A, Koszul R, Lemaire M, Lesur I, Ma L, Muller H, Nicaud JM, Nikolski M, Oztas S, Ozier-Kalogeropoulos O, Pellenz S, Potier S, Richard GF, Straub ML, Suleau A, Swennen D, Tekaia F, Wesolowski-Louvel M, Westhof E, Wirth B, Zeniou-Meyer M, Zivanovic I, Bolotin-Fukuhara M, Thierry A, Bouchier C, Caudron B, Scarpelli C, Gaillardin C, Weissenbach J, Wincker P, Souciet JL: Genome evolution in yeasts. Nature. 2004 Jul 1;430(6995):35-44. [Article]
  3. Burgener-Kairuz P, Zuber JP, Jaunin P, Buchman TG, Bille J, Rossier M: Rapid detection and identification of Candida albicans and Torulopsis (Candida) glabrata in clinical specimens by species-specific nested PCR amplification of a cytochrome P-450 lanosterol-alpha-demethylase (L1A1) gene fragment. J Clin Microbiol. 1994 Aug;32(8):1902-7. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01167Itraconazoleapproved, investigationalyesinhibitorDetails
DB01026Ketoconazoleapproved, investigationalyesinhibitorDetails
DB09040EfinaconazoleapprovedyesinhibitorDetails
DB11633Isavuconazoleapproved, investigationalyesinhibitorDetails