Cathepsin B-like cysteine proteinase
Details
- Name
- Cathepsin B-like cysteine proteinase
- Synonyms
- 3.4.22.-
- Newly excysted juvenile proteins 5 and 7
- Gene Name
- Not Available
- Organism
- Fasciola hepatica
- Amino acid sequence
>lcl|BSEQ0052091|Cathepsin B-like cysteine proteinase KPNYKRQFEPFSDELIHYINLEDLPESFDARQ
- Number of residues
- 32
- Molecular Weight
- 3940.295
- Theoretical pI
- Not Available
- GO Classification
- Functionscysteine-type peptidase activity
- General Function
- Thiol protease.
- Specific Function
- Cysteine-type peptidase activity
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P80529 UniProtKB Entry Name CYSB_FASHE - General References
- Tkalcevic J, Ashman K, Meeusen E: Fasciola hepatica: rapid identification of newly excysted juvenile proteins. Biochem Biophys Res Commun. 1995 Aug 4;213(1):169-74. doi: 10.1006/bbrc.1995.2112. [Article]