Uridine phosphorylase 1

Details

Name
Uridine phosphorylase 1
Synonyms
  • 2.4.2.3
  • UP
  • UPase 1
Gene Name
UPP1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004823|Uridine phosphorylase 1
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA
Number of residues
310
Molecular Weight
33934.005
Theoretical pI
7.95
GO Classification
Functions
uridine phosphorylase activity
Processes
cellular response to glucose starvation / nucleobase-containing compound metabolic process / nucleobase-containing small molecule metabolic process / nucleotide catabolic process / pyrimidine nucleobase metabolic process / pyrimidine nucleoside catabolic process / pyrimidine nucleoside salvage / small molecule metabolic process / UMP salvage / uridine catabolic process
Components
cytosol
General Function
Uridine phosphorylase activity
Specific Function
Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate (PubMed:7488099). The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011758|Uridine phosphorylase 1 (UPP1)
ATGGCGGCCACGGGAGCCAATGCAGAGAAAGCTGAAAGTCACAATGATTGCCCCGTCAGA
CTTTTAAATCCAAACATAGCAAAAATGAAAGAAGATATTCTCTATCATTTCAATCTCACC
ACTAGCAGACACAATTTCCCAGCCTTGTTTGGAGATGTGAAGTTTGTGTGTGTTGGTGGA
AGCCCCTCCCGGATGAAAGCCTTCATCAGGTGCGTTGGTGCAGAGCTGGGCCTTGACTGC
CCAGGTAGAGACTATCCCAACATCTGTGCGGGAACTGACCGCTATGCCATGTATAAAGTA
GGACCGGTGCTGTCTGTCAGTCATGGTATGGGCATTCCTTCTATCTCAATCATGTTGCAT
GAGCTCATAAAGCTGCTGTACTATGCCCGGTGCTCCAACGTCACTATCATCCGCATTGGC
ACTTCTGGTGGGATAGGTCTGGAGCCCGGCACTGTGGTCATAACAGAGCAGGCAGTGGAT
ACCTGCTTCAAGGCAGAGTTTGAGCAGATTGTCCTGGGGAAGCGGGTCATCCGGAAAACG
GACCTTAACAAGAAGCTGGTGCAGGAGCTGTTGCTGTGTTCTGCAGAGCTGAGCGAGTTC
ACCACAGTGGTGGGGAACACCATGTGCACCTTGGACTTCTATGAAGGGCAAGGCCGTCTG
GATGGGGCTCTCTGCTCCTACACGGAGAAGGACAAGCAGGCGTATCTGGAGGCAGCCTAT
GCAGCCGGCGTCCGCAATATCGAGATGGAGTCCTCGGTGTTTGCCGCCATGTGCAGCGCC
TGCGGCCTCCAAGCGGCCGTGGTGTGTGTCACCCTCCTGAACCGCCTGGAAGGGGACCAG
ATCAGCAGCCCTCGCAATGTGCTCAGCGAGTACCAGCAGAGGCCGCAGCGGCTGGTGAGC
TACTTCATCAAGAAGAAACTGAGCAAGGCCTGA
Chromosome Location
7
Locus
7p12.3
External Identifiers
ResourceLink
UniProtKB IDQ16831
UniProtKB Entry NameUPP1_HUMAN
GenBank Gene IDX90858
GenAtlas IDUPP1
HGNC IDHGNC:12576
General References
  1. Watanabe S, Uchida T: Cloning and expression of human uridine phosphorylase. Biochem Biophys Res Commun. 1995 Nov 2;216(1):265-72. [Article]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  3. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  4. Roosild TP, Castronovo S, Fabbiani M, Pizzorno G: Implications of the structure of human uridine phosphorylase 1 on the development of novel inhibitors for improving the therapeutic window of fluoropyrimidine chemotherapy. BMC Struct Biol. 2009 Mar 16;9:14. doi: 10.1186/1472-6807-9-14. [Article]
  5. Roosild TP, Castronovo S: Active site conformational dynamics in human uridine phosphorylase 1. PLoS One. 2010 Sep 14;5(9):e12741. doi: 10.1371/journal.pone.0012741. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB074375-BenzylacyclouridineexperimentalunknownDetails