Reverse transcriptase
Details
- Name
- Reverse transcriptase
- Synonyms
- Not Available
- Gene Name
- rt
- UniProtKB Entry
- Q3MS49TrEMBL
- Organism
- HBV
- NCBI Taxonomy ID
- 10407
- Amino acid sequence
>lcl|BSEQ0052036|Reverse transcriptase MGVGLSPFLLSQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
- Number of residues
- 44
- Molecular Weight
- 4735.565
- Theoretical pI
- Not Available
- GO Classification
- FunctionsRNA-directed DNA polymerase activity
- General Function
- Not Available
- Specific Function
- RNA-directed DNA polymerase activity
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q3MS49 UniProtKB Entry Name Q3MS49_HBV - General References
- Pallier C, Castera L, Soulier A, Hezode C, Nordmann P, Dhumeaux D, Pawlotsky JM: Dynamics of hepatitis B virus resistance to lamivudine. J Virol. 2006 Jan;80(2):643-53. doi: 10.1128/JVI.80.2.643-653.2006. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Reverse transcriptase (HBV) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Tenofovir alafenamide approved no target inhibitor Details Tenofovir experimental, investigational yes target inhibitor Details