Phenazine biosynthesis protein PhzG

Details

Name
Phenazine biosynthesis protein PhzG
Synonyms
  • 1.4.-.-
Gene Name
phzG
Organism
Pseudomonas fluorescens
Amino acid sequence
>lcl|BSEQ0016969|Phenazine biosynthesis protein PhzG
MNGSIQGKPLLGKGMSESLTGTLDAPFPEYQTLPADPMSVLHNWLERARRVGIREPRALA
LATADSQGRPSTRIVVISEISDAGVVFSTHAGSQKGRELLHNPWASGVLYWRETSQQIIL
NGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSEELQDVQAMRNAARQLAELQGPLPRPE
GYCVFELRLESLEFWGNGQERLHERLRYDRSDTGWNVRRLQP
Number of residues
222
Molecular Weight
24934.955
Theoretical pI
9.05
GO Classification
Functions
FMN binding / pyridoxamine-phosphate oxidase activity
Processes
pathogenesis / phenazine biosynthetic process / pyridoxine biosynthetic process
General Function
Pyridoxamine-phosphate oxidase activity
Specific Function
Involved in the biosynthesis of the antibiotic phenazine, a nitrogen-containing heterocyclic molecule having important roles in virulence, competition and biological control. Probably catalyzes the final step in the conversion of trans-2,3-dihydro-3-hydroxyanthranilic acid (DHHA) to phenazine-1-carboxylic acid (PCA).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005931|669 bp
ATGAACGGCTCAATACAAGGCAAGCCGCTGTTGGGTAAAGGCATGTCGGAATCCCTCACC
GGCACATTGGATGCGCCCTTCCCCGAATATCAGACACTGCCCGCCGACCCCATGAGCGTG
CTGCACAATTGGCTGGAGCGTGCGCGCCGCGTGGGCATCCGCGAGCCCAGGGCGCTGGCG
CTGGCCACCGCCGACAGCCAGGGCCGGCCCTCCACGCGTATCGTGGTGATCAGCGAGATC
AGTGACGCCGGCGTGGTGTTCAGCACCCATGCCGGCAGCCAGAAAGGCCGTGAACTGCTC
CACAACCCCTGGGCTTCGGGCGTGCTGTATTGGCGCGAAACCAGTCAGCAAATCATCCTC
AATGGCCAGGCCGTGCGCTTGCCGAACGCCAAGGCCGATGATGCCTGGCTCAAGCGCCCT
TATGCCACGCACCCGATGTCATCGGTGTCTCGCCAGAGTGAAGAACTGCAGGACGTGCAG
GCCATGCGCAACGCCGCCAGGCAACTTGCCGAGCTGCAGGGTCCACTGCCGCGTCCGGAG
GGATATTGCGTGTTCGAGTTGCGCCTTGAATCGCTGGAGTTCTGGGGAAATGGGCAGGAG
CGCTTGCATGAGCGGTTGCGGTATGACCGCAGCGATACAGGCTGGAACGTGCGGCGTTTG
CAGCCCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ51793
UniProtKB Entry NamePHZG_PSEFL
GenBank Gene IDL48616
General References
  1. Mavrodi DV, Ksenzenko VN, Bonsall RF, Cook RJ, Boronin AM, Thomashow LS: A seven-gene locus for synthesis of phenazine-1-carboxylic acid by Pseudomonas fluorescens 2-79. J Bacteriol. 1998 May;180(9):2541-8. [PubMed:9573209]
  2. Parsons JF, Calabrese K, Eisenstein E, Ladner JE: Structure of the phenazine biosynthesis enzyme PhzG. Acta Crystallogr D Biol Crystallogr. 2004 Nov;60(Pt 11):2110-3. Epub 2004 Oct 20. [PubMed:15502343]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails