Beta-lactamase
Details
- Name
- Beta-lactamase
- Kind
- protein
- Synonyms
- 3.5.2.6
- Penicillinase
- Gene Name
- blaZ
- UniProtKB Entry
- P00807Swiss-Prot
- Organism
- Staphylococcus aureus
- NCBI Taxonomy ID
- 1280
- Amino acid sequence
>lcl|BSEQ0016061|Beta-lactamase MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFA YASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTY SDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKT LNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAF VYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
- Number of residues
- 281
- Molecular Weight
- 31348.98
- Theoretical pI
- 10.15
- GO Classification
- Functionsbeta-lactamase activityProcessesbeta-lactam antibiotic catabolic process / response to antibiotic
- General Function
- Not Available
- Specific Function
- beta-lactamase activity
- Pfam Domain Function
- Beta-lactamase (PF00144)
- Signal Regions
- 1-24
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0016062|Beta-lactamase (blaZ) TTGAAAAAGTTAATATTTTTAATTGTAATTGCTTTAGTTTTAAGTGCATGTAATTCAAAC AGTTCACATGCCAAAGAGTTAAATGATTTAGAAAAAAAATATAATGCTCATATTGGTGTT TATGCTTTAGATACTAAAAGTGGTAAGGAAGTAAAATTTAATTCAGATAAGAGATTTGCC TATGCTTCAACTTCAAAAGCGATAAATAGTGCTATTTTGTTAGAACAAGTACCTTATAAT AAGTTAAATAAAAAAGTACATATTAACAAAGATGATATAGTTGCTTATTCTCCTATTTTA GAAAAATATGTAGGAAAAGATATCACTTTAAAAGCACTTATTGAGGCTTCAATGACATAT AGTGATAATACAGCAAACAATAAAATTATAAAAGAAATCGGTGGAATCAAAAAAGTTAAA CAACGTCTAAAAGAACTAGGAGATAAAGTAACAAATCCAGTTAGATATGAGATAGAATTA AATTACTATTCACCAAAGAGCAAAAAAGATACTTCAACACCTGCTGCTTTCGGTAAGACT TTAAATAAACTTATCGCAAATGGAAAATTAAGCAAAGAAAACAAAAAATTCTTACTTGAT TTAATGTTAAATAATAAAAGCGGAGATACTTTAATTAAAGACGGTGTTCCAAAAGACTAT AAGGTTGCTGATAAAAGTGGTCAAGCAATAACATATGCTTCTAGAAATGATGTTGCTTTT GTTTATCCTAAGGGCCAATCTGAACCTATTGTTTTAGTCATTTTTACGAATAAAGACAAT AAAAGTGATAAGCCAAATGATAAGTTGATAAGTGAAACCGCCAAGAGTGTAATGAAGGAA TTTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00807 UniProtKB Entry Name BLAC_STAAU GenBank Protein ID 581568 GenBank Gene ID X04121 PDB ID(s) 1ALQ, 1BLC, 1BLH, 1BLP, 1DJA, 1DJB, 1DJC, 1GHI, 1GHM, 1GHP, 1KGE, 1KGF, 1KGG, 1OME, 1PIO, 3BLM KEGG ID pg:13874750 NCBI Gene ID 13874750 - General References
- Chan PT: Nucleotide sequence of the Staphylococcus aureus PC1 beta-lactamase gene. Nucleic Acids Res. 1986 Jul 25;14(14):5940. [Article]
- Gillespie MT, Skurray RA: Nucleotide sequence of the blaZ gene of the Staphylococcus aureus beta-lactamase transposon Tn4002. Nucleic Acids Res. 1989 Nov 11;17(21):8854. [Article]
- Rowland SJ, Dyke KG: Tn552, a novel transposable element from Staphylococcus aureus. Mol Microbiol. 1990 Jun;4(6):961-75. [Article]
- Wang PZ, Novick RP: Nucleotide sequence and expression of the beta-lactamase gene from Staphylococcus aureus plasmid pI258 in Escherichia coli, Bacillus subtilis, and Staphylococcus aureus. J Bacteriol. 1987 Apr;169(4):1763-6. [Article]
- McLaughlin JR, Murray CL, Rabinowitz JC: Unique features in the ribosome binding site sequence of the gram-positive Staphylococcus aureus beta-lactamase gene. J Biol Chem. 1981 Nov 10;256(21):11283-91. [Article]
- Ambler RP: The amino acid sequence of Staphylococcus aureus penicillinase. Biochem J. 1975 Nov;151(2):197-218. [Article]
- Herzberg O, Moult J: Bacterial resistance to beta-lactam antibiotics: crystal structure of beta-lactamase from Staphylococcus aureus PC1 at 2.5 A resolution. Science. 1987 May 8;236(4802):694-701. [Article]
- Herzberg O: Refined crystal structure of beta-lactamase from Staphylococcus aureus PC1 at 2.0 A resolution. J Mol Biol. 1991 Feb 20;217(4):701-19. [Article]
- Banerjee S, Pieper U, Kapadia G, Pannell LK, Herzberg O: Role of the omega-loop in the activity, substrate specificity, and structure of class A beta-lactamase. Biochemistry. 1998 Mar 10;37(10):3286-96. [Article]
- Chen CC, Herzberg O: Relocation of the catalytic carboxylate group in class A beta-lactamase: the structure and function of the mutant enzyme Glu166-->Gln:Asn170-->Asp. Protein Eng. 1999 Jul;12(7):573-9. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Degraded Cephaloridine experimental yes target inhibitor Details [[N-(Benzyloxycarbonyl)Amino]Methyl]Phosphate experimental yes target inhibitor Details Sulbactam approved yes target inhibitor Details Cefroxadine withdrawn no enzyme substrate Details 4-iodo-acetamido phenylboronic acid experimental yes target inhibitor Details 2-(N-morpholino)ethanesulfonic acid experimental yes target inhibitor Details M-Aminophenylboronic Acid experimental yes target inhibitor Details N-2-Thiophen-2-Yl-Acetamide Boronic Acid experimental yes target inhibitor Details Hydrolyzed Cephalothin experimental yes target inhibitor Details 4-(Carboxyvin-2-Yl)Phenylboronic Acid experimental yes target inhibitor Details 4,4'-Biphenyldiboronic Acid experimental yes target inhibitor Details Sucrose approved, experimental, investigational yes target inhibitor Details 3-Nitrophenylboronic Acid experimental yes target inhibitor Details 4-Carboxyphenylboronic Acid experimental yes target inhibitor Details Acylated ceftazidime experimental yes target inhibitor Details Benzo[B]Thiophene-2-Boronic Acid experimental yes target inhibitor Details 4-[(METHYLSULFONYL)AMINO]BENZOIC ACID experimental yes target inhibitor Details 2-phenyl-1H-imidazole-4-carboxylic acid experimental yes target inhibitor Details Carbamic Acid experimental yes target inhibitor Details Acetate experimental yes target inhibitor Details Clavulanic acid approved, vet_approved yes target inhibitor Details Nacubactam investigational yes target inhibitor Details Cyclohexanol experimental yes target modulator Details Relebactam approved, investigational yes target inhibitor Details Vaborbactam approved, investigational yes target inhibitor Details Enmetazobactam approved yes target inhibitor Details Tazobactam approved yes target inhibitor Details